SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015793 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015793
Domain Number 1 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.88e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 583-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000813
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 4 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000108
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 460-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000409
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000771
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015793
Sequence length 706
Comment (Oryzias latipes)
Sequence
QEEASRRLGRCEPKVMARLVDISTQTDPVVVLSLAQAAVLGLISQNEVFGATIAPNGFYT
GEPKESPAPTVDGVDYEYADQLIGANGDYLGENLEDNQMQPSCSQRRWQQGPPQHPDEKM
ILPNRHGLQGSDLPVASSHVKGEVVTSGMPSCVHMLNNMAPRGGLVQVDPAALRGTNKNC
AECEREATNQQQANPHVHPAPPQVAHRGPEQGHRGLPGQRPMGGHGRGGREGEEEVEHQT
NAMMKPTQQEEAISSYFQTSEVGSYDSTEMGMGGEYEDGSQSMMWTDPPRRHGGRRVDRL
DINIQIDESYCVDVGDGLKRWKCRMCDKSYTSKYNLVTHILGHNGIKPHACPHCGKLFKQ
PSHLQTHLLTHQGTRPHKCTVCKKGFTQTSHLKRHMLQHTDIKPYSCRFCRRGFAYPSEL
RAHEVKHERGRCHVCSQCGMEFPTYAHLKRHQTSHQGPHTFQCTECNKSFAYRSQLQNHL
LKHQSPRPYTCSQCGLEFVQLHHLRQHSLTHKKCVLVSSVHLSKGMKGHKCDVCSREFTL
SANLKRHMLIHNSVRPFQCHVCFKSFIQKQTLKTHMIVHLPVKPFKCKVCGKSFNRMYNL
LGHMHLHAGSKPFKCPYCTSKFNLKGNLSRHMKVKHGMDVSPEGQAEVLPEMESQGDYES
QNFSFTSPDSMDNSGSQNLTKLTTANMEDMEEYYNFGKDTGSYSTP
Download sequence
Identical sequences H2MB72
ENSORLP00000015793 8090.ENSORLP00000015793 ENSORLP00000015793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]