SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000018001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000018001
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-27
Family Frizzled cysteine-rich domain 0.0015
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000018001
Domain Number - Region: 572-646
Classification Level Classification E-value
Superfamily BTV NS2-like ssRNA-binding domain 0.0693
Family BTV NS2-like ssRNA-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000018001
Sequence length 721
Comment (Oryzias latipes)
Sequence
CKKTTTCEVLKYNTCLGSPLPYSHTSLILAEDSSSQEEVFEKLTMWSGLRNAPRCWSVIQ
PLLCAIYMPKCENGQVELPSQSLCLATRRPCSIVDQERGWPTFLKCDQFPVGCSNEVQKL
KFNTSGQCEAPLVKTDIQSSWYKDVEGCGIQCDNPLFTQDEHNDMHAYIAYFGTITLLCT
FFTLATFLADWKNSNRYPAVILFYINACFFVGSIGWLAQFLDGARKEIVCKSDNTMRLGE
PSSSETLSCVTIFIIVYYSLMSGVIWFVMLTYAWHTSFKALGTTHQPLSGRTSYFHMVTW
SVPFVLTVAILAIAEVDGDSVSGICFVGYKNYKYRAGFVLAPIGMVLLVGGYFLIRGVMT
LFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWEKSFR
EYVLCEANVTIASQTNKPIPECTIKNRPSLMVEKINLFSMFGTGIAMSTWVWTKATILIW
KRTWFKILGRSDNEPKRIKKSKMIAKAFAMRKELHKDPEKELSFSMHTVSHDGPVAGINF
DINEPSNDVSSAWAQHVTKMVARRGAILPEDISVTPTGTPVPPPEERNRLWLVEAEISPD
MIKRKKKKKKKRRKEVRPAEEVADPQPYPQREFGRSSVPRLPKLPCNSSLVGNLHRQQRE
QQKMEEEVLPGSCPDFPPSHPLSYEERCPYLQCQDTMAGYGPVHSRTNLMEAELMDADSD
F
Download sequence
Identical sequences H2MHA0
ENSORLP00000018001 ENSORLP00000018001 8090.ENSORLP00000018001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]