SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000018060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000018060
Domain Number 1 Region: 258-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 198-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000256
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 153-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000127
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 301-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000358
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000018060
Sequence length 794
Comment (Oryzias latipes)
Sequence
MSGNGPHSEVPMYYEVEVDPLEEGDERDTKIRFEKDDLIPESSSSSGRVYDRTTVLIERD
PIRLDEEGEEEGHCGGDDDGVTFLTEGEGDGDEEDGSLGFMADTDGMSQGYVHHTISPDQ
IQFTINPGSTPMPRNIEGATLTLHSECPETKQREVKRYQCTFEGCPRTYSTAGNLRTHQK
THRGEYTFVCNQQGCGKAFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQR
LHTGKTFNCETEGCTKYFTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRT
HTGEKPFNCPSDGCEKTFSSQYSLKSHIRGHDKGQPFSVTLTHPHSEDANHSLCLSDLSL
ISTDPELRESISNSQNLDLSVTQGKILEFIFQSPENSVSQDDGHPNERLAEAFSQETQRG
MTEASSIISFSVNPTYSSSCSHNAAVVESSSQHCQSYSSQTSTVSAAVSSTQPPPFTQLS
GPQQISDVPQASVQANNVTPQHYVALQPTFLPSEGDTQASVHPPAVPALAPTPPGPVAVA
APPAEGLVAVTQPVPLANPPVTNSGPSLAPAPATITIASTPNLLQPSLVMSDQNLQWILS
SAANSQQNLEQTAIFTTPLVALFFPRGSPLLGGVSGSSVQQIGLSLPVIIIKQEESCQCQ
CACRDSAKDKNAKSASSISSAPAQPQPQQQPQLCIRTFNQPAASSSSSCCLPKSSSTADE
LRPDAPSSSPPSSSTAQTFSTSVSNAATSTPPTDGFASMDVSDFLSMQSPETAANLEALL
LVADEFNMATDGNA
Download sequence
Identical sequences H2MHF5
ENSORLP00000018060 ENSORLP00000018060 8090.ENSORLP00000018060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]