SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000019853 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000019853
Domain Number 1 Region: 453-534
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.68e-29
Family Forkhead DNA-binding domain 0.0000142
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000019853
Domain Number - Region: 298-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000019853
Sequence length 668
Comment (Oryzias latipes)
Sequence
MMVESASETIRTTPSNQNGVSSLSSQSDGGGGREGGSNGDVNGEISPVDLLHLQQQQALQ
AARQFLLQQASGLNSPGSNEVKQSPVQVPVSMAMMSPQMITPQQMQQILSPPQLQALLQQ
QQALMLQQLQEYYKKQQEQLHLQLLTQQQQQQQQQQQQQQQAGKQAAKEQLGSKQLAFQQ
QLIQMQQLQQQHILNLQRQGLVPMQPTAAMQSLQQAMCPSDLQQLWKEVSGVPSSEEALK
QAEGLDLSTNSSNSTSAFPKAANAHIPLHNLPNGQNHTPKRDSHEEHTGSHPLYGHGECK
WPGCEALCEDMGQFIKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQAMMTHL
HMRPSEPKPFNQPVSTSCEAYPEGLPHPPTSAATPITPLRQGPSVISSSSLHTHSHSHTH
PVGPIRRRNSDKYCTPIASELAQNCEFYKNADVRPPFTYASLIRHAILESPDRQLTLNEI
YNWFTRKFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRPPKMTG
SPTLVKNMISGLGFGSLNASYQAALAESSLSLLNSPSLVTPPSAASLNMLHVGHDDVSST
VEQVNSNGSCSPTLSPQQYSHPVHVKEEPTEVEEDSRPVSLLAGVTHSLPLPSDERDLEE
DLPTEELE
Download sequence
Identical sequences H2MMB3
ENSORLP00000019853 ENSORLP00000019853 8090.ENSORLP00000019853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]