SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000022713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000022713
Domain Number 1 Region: 576-726
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.7e-67
Family Ankyrin repeat 0.000000872
Further Details:      
 
Domain Number 2 Region: 47-287,336-361
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-63
Family BAR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 453-571
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00000695
Further Details:      
 
Domain Number 4 Region: 341-435
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-20
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 5 Region: 1066-1145
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-18
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000022713
Sequence length 1146
Comment (Oryzias latipes)
Sequence
RDPAAQRLCRLRLQFAMPDSISVSDFVAETNEDFKAPTTSSFTTRMPECRSTVIALEEGL
DSDASLLHKIKKSLKAIHSSGMAHIESQEQYFQSLEKFGQRFLSKDDDCEIGSAFIKFNL
LTKELTALFKNLVQNMNNIIFFPLESLLKGDLKGVKGDLRKSFDKAWKDYETKLAKIEKE
KREHAKQHGLIRSEIIPGEIAEDMEKERQMFQLQMCEYFLKVNEIQVKKGVNFVQNLIKY
FQIQGNFFQEGLKAVEDLKPSVEKLASNLVTIKQNQDGERKQLTQIRDMLKASMQAEQKE
VGFLWLYVGPYNNCKKDLQLKQSAGYSLHQLQGDKVYGTERDGVLYKRSEGLRRVWQKRR
CFVKNGFLNICHGTSNRDPAKLNLLTCQVKRNPDEKKSFDLFSHDRIYHFQAEDEIECQI
WVSVLQNSKEEALNDAFKGGSNEGENNIVQELTKSIVEEVKKMNGNDRCCDCGAAGPTWL
STNLGVLICIECSGIHREIGVHYSRIQSLDLDVLGTSEMLLANNVGNASFNGIMEADLGP
QGITKPDPSSDMQTRKEYITAKYTEKRFARRLYTNTESRQKALYEAVRNKDVLSLLQVYA
EGVDLMEAVPQPSEHEHGETVLHLGVRMADRNSLHIVDFLAQNSPNLDKQTAKGNTALHY
CCLLDNRECLKLLLRGRASVSITNEAGETPLDIAKRLQHSTCEELLTQVQTGKFNVHVHV
EYQWRLQNEELDESEDEMEDKPIPSRRDERPISCFVPSAALQPSLAALARDAASMVRDKQ
RPPIPSSMISNETYGTAMDFSRPPPRPSPPPLPNRGLNKGGGASGGGIAKPEVGRQRSLS
DPTVLTLIPSAPPHSATSCPPSPRQLGVENCVSEEPSPPSCSLPTSRTTSCPTSTFTSTA
FNTQTTSPPPTSTKLQNEWTIRTTRTQAPNAPPWVSAKTKSITVSMILSVQMSDPYWSVP
SKLSSTSHNEKKPLRPDWLWTRPESKSVRPSTVYQCKIWWRYAAPAGRPALHPVFAASLI
QMLLQADPAETLNQSNSVFGRLAKQPPQRPPVRTGSVEKSGLQSKSPHSPAPPLPKPRKN
LSQQKPKRVKAIYNCSADQPDELTFKEGEVIVVEGEEDHDWWIGHVEGDPGRRGAFPVTF
VHFISE
Download sequence
Identical sequences H2MV86
ENSORLP00000022713 8090.ENSORLP00000022713 ENSORLP00000022713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]