SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000023139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000023139
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000523
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000023139
Sequence length 37
Comment (Oryzias latipes)
Sequence
TLIQQKTDDSPDIKDFLKRLAMDPRCKGMPLSSFLLK
Download sequence
Identical sequences H2MWB5
8090.ENSORLP00000023139 ENSORLP00000023139 ENSORLP00000023139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]