SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000023187 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000023187
Domain Number 1 Region: 1632-1748
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-36
Family Pleckstrin-homology domain (PH domain) 0.00035
Further Details:      
 
Domain Number 2 Region: 1505-1636
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-19
Family DBL homology domain (DH-domain) 0.00051
Further Details:      
 
Domain Number 3 Region: 686-826
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000746
Family CRAL/TRIO domain 0.0083
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000023187
Domain Number - Region: 917-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0189
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000023187
Sequence length 1786
Comment (Oryzias latipes)
Sequence
DSESLDRCIQAALADLYPPFQATSPTVLCQVLSVVESCFRGDGLQYLIHFLLPAKQLLQS
VQQDACLPFSGLLFRHEGWPLCIHEKIVVQLCPLDPRLLQPGDFYLLVSPPAAPPISRSR
YTAPCRRSVTPPPRLLLCSCLAAGPDVEQQEVTTVALRTLFTMAWLDSVNRDREQRGGPR
LERCLLSAHGDVFRVPWEDLVYPQFISRTNHRDDEKTSVKSRDTNSHASSDGEESEGEYV
ELTELPRFSPQKGSLTQSISLQNRARSSNQICAHTRTYAATHMCRSGSQAEPAEGTASHK
DTLNLHPETETCTKLEEGGKEEEGRGQEELRCEAVCEKEKRKDDVLKQKPIEISFSENKA
QQSCTEGFYFENNSLQICPESSYSEGAQEPVPQNSYSEKSVLQTQPADSYSESVLQKQPG
NSYSESVLQKQPGNSYSESVLQTQPRDSYSESVLQTQPGDSYSESVLQTQPGDSYLESTI
QTPFKDSYSERTAPTSSEDSYFENNSKNAWPENCQHGSTAEAHPEGSYSEGVPQSEDHYF
EGRGFTRPAVESGSLLGSDPRQSPLAPAASPGPTQPKGSYSEGGQRGGGEAAGGGSAEHQ
HEGTGTSSIPFCQSDSHLPKLLPLLQLADTFLIQISNPAERCVFVFPDVSSEPPAVPSAA
QRPTEPEHPPAAPTVTVQNPHSSFHSVLLKSGAVCLPGSRDRGGRALLTVCPAHSVWTHP
ECDSAELLRLLLFYTSTLRKETLTLGLTVLVDTRRAPPAPALFSALGLLQEDHPGSIHAV
LILAIKDSCLHLDKPAATPVEVVSSLKSLQKHVELQQLPADFGGSFIFSQSSWIAFRTRV
QQLTNQCNSVVDLLQKAIRALQGTPLPAVATDAQVLLSRDEAVMHSILQDARLLQLQQEG
GASLSWLRREEAGGASEQQREAVRAVASLYDQVDELLHCLVTLSNSRTQEIHFILDFWNL
EDGFSQVRAWLEEEGEVHLKTLEEPADSLELLNKKQLDFKEFYATAYDQCKRGEELLGRL
ERWNDMSSSNLQAYELKVHSFWAQLQDFSQRVKSTGQNIERTVQLYCFLDQVGEVAGKDP
SLVPEMEFLPFKMFASLVPLLVRLHSHNQEDQNQAHQRKCTLQDRKSSSCHIGVHYVWEL
WTAIRPAALCERATEFGRTGSPGKSVCPGRARTVSSHSGFGAVRNSAQSLETVQTITWIC
VSCPNKIKAAVIPTHLRSASLQRFPHGFMFSCRKFSAIHDSMSKMHFKSVLTDSSSSGDT
VLSGATASMADCSLLLKCSTIKSHDAENKKLKFSGEASVRTTGASAPSQVSVKRRQSKLL
SKMSSFTIKDLFKRERMFKTAKFKTVRVCRWIDLSFLSGNNFRTPVCVAMRPAGGRGVQT
SRDSSGLISHGFWCGQTNTKPEPCWLDPAGFDDASDSGMSGTTSGVHVNTTFELSVETKR
FLLKPRRRNSLRRRKVHDFYQTETRVAEGTSERSFTPILVHPLTAVSGGGTHGLFIYDNY
IYMHSFLDWMEKESSKNVTINLSVLEQQEQFSLYALYSKNKPKSDALLASHGHAFFRRKQ
LELEDKMDLSSYLLKPIQRMSKYALLLTDLMKEVGVAQEAELGALQAATSMVKFQLRHGN
DLLAMDAIRDCDVNLKEQGQLIRQDEFTVWSGRRKCQRHVFLFQELVLFSKLRKVEGGLD
VFIYKQSYKTADIGLTESTGDSGLRFEIWFRRRTSKNQTFIFQAPSAEVKRAWTGDIARI
LWTQATRNKEMRLKEMVSMGVGSKPFLDIQPSDAAISNRAVHIMKT
Download sequence
Identical sequences H2MWF0
8090.ENSORLP00000023187 ENSORLP00000023187 ENSORLP00000023187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]