SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000023221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000023221
Domain Number 1 Region: 96-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000023221
Sequence length 176
Comment (Oryzias latipes)
Sequence
LSPASHSPHLYPQDGFKMEPMASDMLQQEAYSLEEPPETSVSHRPKPQRRSSSRGAGQAV
CRCPNCVHAEQMGQSPDDSRRKHMHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWL
FCGKRFTRSDELQRHLQTHTGAKKFSCALCPRVFMRNDHLAKHMRTHESPPGQGEE
Download sequence
Identical sequences H2MWH5
8090.ENSORLP00000023221 ENSORLP00000023221 ENSORLP00000023221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]