SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000024150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000024150
Domain Number 1 Region: 13-208
Classification Level Classification E-value
Superfamily eIF4e-like 5.76e-76
Family Translation initiation factor eIF4e 0.0000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000024150
Sequence length 212
Comment (Oryzias latipes)
Sequence
IIVCLSLQKAADTEDQQQTDGQVLANAEQYIKHPLQNRWALWYFKNDKTKSWTENLRLIS
KFDTVEDFWALYNHIQQPSKLVLGCDYCLFKDGIKPMWEDDKNKLGGRWLMTLNKQKHND
LDRYWMETLLCLVGESFDDASEEVCGAVVNVRHKGDKISIWTGNCQNKEAIMTIGQLYKE
RLNLPMKAIIGYQSHDDTSSKSGSTTKNMYSV
Download sequence
Identical sequences H2MYQ2
ENSORLP00000024150 ENSORLP00000024150 8090.ENSORLP00000024150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]