SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000025266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000025266
Domain Number 1 Region: 92-216
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-28
Family Pleckstrin-homology domain (PH domain) 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000025266
Sequence length 219
Comment (Oryzias latipes)
Sequence
MPDAISKLLQDLQSLEAELGQTAERWKDTWDKIKMTQRTDAKPESKPSFSSSLLMASNLS
HQRRSQGVCLQESAVGPSLNLGLDCEGGATSTPVPGRTSTSTLYSQFQSTESENRSFEGI
LYKRGSILKPWRPRWFVLDKTKHQLRYYNTRQDKECRGFIDLAEVEAVTSGSPMVTSPKI
TEKAYFDLKTTKRVFCFCAQDAASAQQWMDSIQSCLSDA
Download sequence
Identical sequences H2N1G3
ENSORLP00000025266 ENSORLP00000025266 8090.ENSORLP00000025266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]