SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000025502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000025502
Domain Number 1 Region: 1540-1714
Classification Level Classification E-value
Superfamily Fibronectin type III 4.87e-29
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 2 Region: 1263-1440
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-26
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 3 Region: 1724-1896
Classification Level Classification E-value
Superfamily Fibronectin type III 7.43e-25
Family Fibronectin type III 0.00087
Further Details:      
 
Domain Number 4 Region: 1914-2083
Classification Level Classification E-value
Superfamily Fibronectin type III 1.83e-24
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 5 Region: 721-888
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-21
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 6 Region: 405-460
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-20
Family Fibronectin type II module 0.00011
Further Details:      
 
Domain Number 7 Region: 906-1066
Classification Level Classification E-value
Superfamily Fibronectin type III 8.03e-20
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 1448-1537
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-19
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 9 Region: 347-400
Classification Level Classification E-value
Superfamily Kringle-like 1.77e-19
Family Fibronectin type II module 0.00036
Further Details:      
 
Domain Number 10 Region: 555-601
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000085
Family Fibronectin type I module 0.0021
Further Details:      
 
Domain Number 11 Region: 2358-2401
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000196
Family Fibronectin type I module 0.0014
Further Details:      
 
Domain Number 12 Region: 1092-1264
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000238
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 13 Region: 513-557
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000366
Family Fibronectin type I module 0.0036
Further Details:      
 
Domain Number 14 Region: 470-507
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000124
Family Fibronectin type I module 0.0025
Further Details:      
 
Domain Number 15 Region: 618-698
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000185
Family Fibronectin type III 0.0000263
Further Details:      
 
Domain Number 16 Region: 182-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000284
Family Fibronectin type I module 0.00034
Further Details:      
 
Domain Number 17 Region: 2313-2356
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000389
Family Fibronectin type I module 0.0027
Further Details:      
 
Domain Number 18 Region: 92-137
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000493
Family Fibronectin type I module 0.00022
Further Details:      
 
Domain Number 19 Region: 140-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000523
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 20 Region: 229-272
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000536
Family Fibronectin type I module 0.00026
Further Details:      
 
Domain Number 21 Region: 2400-2442
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 22 Region: 302-340
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000144
Family Fibronectin type I module 0.0013
Further Details:      
 
Domain Number 23 Region: 50-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000864
Family Fibronectin type I module 0.0028
Further Details:      
 
Domain Number 24 Region: 2224-2287
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000151
Family Fibronectin type III 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000025502
Sequence length 2496
Comment (Oryzias latipes)
Sequence
AMAGRSSAFAGVLVALCVGSAVNCMPKGTERDRRQAPQPNVPSVNQAGAEGCTENGHFYS
INEQWERPFRGSTLICTCHGVAGIKCNSKPEAEEKCYDKEIQQYYAVGETYERPKDGMIW
DCTCIGSGKGKISCTIANRCHEGGASYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKP
VAERCYDSSAGASYLVGETWEKPYQGWMVMDCTCLGQGNGQITCTSRNRCNDQDVLKSYR
IGDTWTKTDARGNLLQCLCMGNGRGQWKCERHASLHTTGLGSGSRVITNIQPVSLPQTPQ
EGTCATDSGLTYFVGQRWFKNQGARQMICTCLGNGISCDQWDGPAPVYGGNSGGLPCVFP
FVHKGKTYLSCTSDGRSDGQLWCSTTSDFEKDQKYSFCTEKKVVVATRGGNSNGALCHFP
FLYNGRNYTDCTADGRRDGMKWCGTTANYDAEQRFGFCPMAAHEEACTSSEGVMYHVGDQ
WDKRHDVLGHMMRCTCVGNGRGEWSCVAYSQLKDQCSVDGLTYEVNQTFTKQHEEGYMMN
CTCFGQGRGRWKCDAVDQCQEPETRAFYQIGDTWDKVIQGILYKCYCYGNGVGELSCEPQ
QSFSGGYRPVQVIITESGNQPNSHPIQWNSPSSAHIVQYILKWRVKDSRSPWREVMIPGH
LNSYTISSLKPGITYEGQLISVLRFGRKEVTRFDFTTTYGSLATSQGEATPLPAVMDTSE
SVTEITSNSFVLSWVSASDTVSGFRVEYELTEQGQGRGQPMVLDLPRTANSVIISELEPG
TNYTVYVYEVIDGEKENLILTTSQTTAPDAPKEHDVEEVGETSIMISWEKPLAPITGYRV
VYTPSLEGESNELTLPDTATSVTLSDLMPGKSYNISIYAVEHSLESEPIFVQVTTAGDPL
PDEVESPTSLQFFEVTDNRVVLTWSGPQGGVSGYRVTVVAVENSGSPQTEMNLPVGQNPY
SEVTHLEPGTLYRFNVYSIHNGEESLPLVGEQTTKPDAPTDIHFTNVTEDSAVVQWFAPR
AKVNGYRLFITVEGSNPMQLRLPARLSQYTLLNLKPDTQYTVTMHSEQGNTLSAGESAGF
TTNPPLGNAPQFTTDVTDTSIVVSWTPVPHIGYKLTVRPSLGGEAPRDVTSESGSIYISG
LTPGVEYTYSLQPVVNGQDQGTPVTSHVVTPLSPPTDLNLESIPGTGELLVRWNGAGVPD
ITGFRVSCAPTKGQQGESVEEHVDAGKDFWVLENLLPGVEYNVSVVTVKGDMESSPVSTV
ITPEVPQLTDLSFEDVGDTSISLRWSPFNTTAITGYKIMVVTAGESLPIFEDTVSSGTGH
YTVYGLEPGIDYEISVITITENGESEPTTFTHQTSVPAPTDLGFGEVGPDTIELTWAPPA
VPNPAHINSFIIRYHPTDDEDEITETSVRGGTDRVVLRNLLPNTEYLVSVVAVYEQREGS
PLVGTKKTALDSPMGLRFSEILTSSFTVHWLAPQSRFSGYRIRYQMTSGGRAKDERLPPS
RNYFTLTGLTPETEYLVHIYAVSGSEESLPLSGTQKTISDAPTDLEVLDSTPTSITVRWT
PPPVTVRYYRITHGETGGESNPKEFTVPGSKSTAVIDSLKPGTDYTITVYAVTGRGDSPA
SSIPIHVSHRTGVDSPSDMEVTDVNDNSVTVRWSPAPGPIKGYRVTGVPRNGQGQTYTEE
VAPDQTELTFSGLMPSEEYIFSVSALGQNGESSPLVVNALTNVDRPKDLTFSDVDSTSLR
ITWDSPEGIVTSYRVLYSSPEEGERELLPAPRGDAESAVIHGLQPGTEYTVKVLATHNGK
VSPPLTGTQATAISAPSGLQFSQVGPTSFIIHWTAPGQENRINSLSGLTGYRVVVNPKTK
SGPTKEVSLAPDSTQAHISGLMIATTYEVHVYALKNSLTSRPVRGEVTTLENISPPRRVR
IADVNDSSITLMWRYKTETISGFLIEATPTLSPSGYVPIRRTIGPDSRSFTITGLEPGTS
YKISIYTLKGNGRSIPQTQTATTALALIIPPTNLRFTSLNPTSISFTWDLSRSPRVTGYY
VTYEEAGGLPLELVPRPHAGQSSATIRGLKAGTEYVIKIVALQNSLRSTPLVGKARTQPL
MPNLPVPHRTNTEILDVPESFDDKFFNSNYVHLAGTSGQNQPGQQGQHIYTEDQNLGPNN
GLHGPFNGPREGQRATLREPLVYVPVAGPDGQRVPLVKVSESHLPGLALAFPENETELPQ
EAQTVTTISWQAVPETSEYEVSCNPVTLREETGFQTRLPGSYNSATLIGLTSGASYNVVV
EAMKEGTKEKVLEEVVTVGNAVPGDVPVSASQDVCYDTLTHTHHQVGAEWERMSEMGFKL
WCRCLGLGSGHFRCDSSKWCHDNGNNYRVGERWDRRGENGHMMSCTCLGNGKGEFKCEPH
ESTCYDDGKMYQVGNQWQKEYLGAICTCTCYGGQQGWRCENCRRPGVLHVSPPATTRGRQ
TCQITANLLNCRTDNIHCPIECLRPELLADAQSQLE
Download sequence
Identical sequences H2N233
ENSORLP00000025502 8090.ENSORLP00000025502 ENSORLP00000025502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]