SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI25524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI25524
Domain Number 1 Region: 79-189
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000301
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI25524
Sequence length 318
Comment (Monosiga brevicollis)
Sequence
MMRLALALVLLAASTAGVPLQRREASPSPVTIDASGDSQLLASTVAPTTTTTTTTTTTTT
TTTTTTTTSTVHMCAQDDAYEPNDTYNWAAILPIPSVSNLRLCDTGDYFRITVCNGATVS
VHLTFNSSNGDLDMAIYDSPNGVLLDSSATSGNEESITFVNDSPGVGTTEFVIRVLSLSN
HINAYTLNVSLDDECNEPTTVVPTTTELEITTPDLSTPVCPDNFIIRTYARDRTFDVTFT
VSCPYGHIVRFCNDRDDDAVELILFDDQVVASDYTHLQYYVPPEVAIEGKHYSLLVWSSR
RTAIEIYGHLLISECVTQ
Download sequence
Identical sequences A9UZN7
XP_001745975.1.20067 jgi|Monbr1|25524|fgenesh2_pg.scaffold_10000174 81824.JGI25524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]