SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI26939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI26939
Domain Number 1 Region: 361-455
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000144
Family Collagen-binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 170-310
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000122
Family Reprolysin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI26939
Sequence length 644
Comment (Monosiga brevicollis)
Sequence
MRATLSQLLLLAGLACTLASSRLTTDNIENYLAADQVQQLKGLSRAAHNQLARQLERVHI
DTADGSNLELDAWGMFRIVDTVDADEMAAQAKASEHGPRQRRSLLAQASAYRSDGLPLLH
SKPGAPNVIYLDFDGHQQPDYGYGWAGGFDAKPYNLDGDAKSFSAVETANIIDVWGRVAE
DFAPFDVDVTTVEPSSFGSRTTRCLITSRQQRDGSYMPHGSSAGGVAFVGVFGTSYYQPY
YSPALVYFDNLGGSKTIAEASSHELVTPQIGHNLGLPHDRREGEGYFTGVGSSSDPTSWG
PIMGAPYSKSVTQWSKGLNGVTGSANDEDDIYIIEALLSLRQDEAGETADSAAVMTVVDA
STIQASGIITEEDDVDVWRFTVVDQGIVTLSVNPWYSGGNINGNNLDVAVQVRNAAGSVV
AADARNGQTNAEISFSAQVGTYYLYVWGDGDGTYYPSAYGSLGQYTVQGSGHFGMSLPTT
TKSTTTTTTTTTTTTTTTKSTTAQSTTTTTTTTTTTTSSEDGVASCSCPSRRVKSFFDDD
RTMGFRFKQDCAQGHTFQFCVRRSEDSRKQMTVQLELDSDVVAGPLQVESGLGAMACLRY
DVPPALAVDGNKFTLHIINENAQAFQVMHDRRKITRTKHCEPQF
Download sequence
Identical sequences A9V3Z5
XP_001747425.1.20067 81824.JGI26939 jgi|Monbr1|26939|fgenesh2_pg.scaffold_16000127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]