SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000000153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000000153
Domain Number 1 Region: 336-543
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.91e-52
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000394
Further Details:      
 
Domain Number 2 Region: 193-334
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 7.06e-43
Family Domain of poly(ADP-ribose) polymerase 0.0000476
Further Details:      
 
Domain Number 3 Region: 52-165
Classification Level Classification E-value
Superfamily WGR domain-like 5.36e-38
Family WGR domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000000153
Sequence length 544
Comment (Xenopus tropicalis)
Sequence
MAPKRKAATQAKASGKNKKAKVKKEIKEEETEQPLKAPDRFQSAVQALKAASGKKGKAKI
DSSCHLSSYGDYEVYEDYDCMLNQTNIGSNNNKFYVIQLITKKNEYYCWNRWGRVGEVGQ
SKLSPFPKLENAQKDFEKKFKDKTKNSWSERENFTPHPGKYTIIEVEHDDDNGSGEATVK
ADTVDGTVQKVRPCSLDKPTQDLISLIFSTDMFKEAMQTMNLDIKKMPLGKLSKAQIAKG
FEALDELQAALDRKANKGVLSDLSSRFYTIIPHNFGRRTPPVIDTSEVLQAKKDMLLVLA
DIELAQTLQADKVKKEEEEEKVQEVPHPLDVDYELLKCDLSLLDTSTEEYKVIKTYVENT
GPTYRTLKIQNVWCVNRETEEERFSAHKDIENRRLLWHGTNIAVVVAILKSGLRIMPHSG
GRVGKGIYFASENSKSAGYVGCTSKNLGIMFLNEVALGREHHIKMDDCSLQSPPKGYDSV
VARGLTEPEPAKDRKLDLDGRKITVPQGRPVKMEKYSDSSFGQSEYLVYKESQARMRYLL
LLKF
Download sequence
Identical sequences F7C163
8364.ENSXETP00000000153 ENSXETP00000000153 ENSXETP00000000153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]