SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000002646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000002646
Domain Number 1 Region: 180-242
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.96e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 4-44
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000645
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000002646
Sequence length 260
Comment (Xenopus tropicalis)
Sequence
SWGMAVNVYSTSVTSENLSRHDMLAWVNDSLQLNYTKIEQLCTGEWPSGSWGPPAGTPLS
SITPPPEIWASGFLPRALGTTPAPPPFAPPHALVLRGRGCHGATLLSGFHVALSAVYISR
WVFMSSALQFLPSAPLTVPQRTSPTGPKTMQAPVRLQNTAPPLRKNPPITRNGGHDMDSQ
VVELNQQLVELKLTVDGLEKERDFYFSKLRDIELICQEHESENVGVLSKIIDILYATEEG
FAPPDDDENDDPQPEDQDEY
Download sequence
Identical sequences 8364.ENSXETP00000002646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]