SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000007509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000007509
Domain Number 1 Region: 219-461
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-83
Family Eukaryotic proteases 0.00000723
Further Details:      
 
Domain Number 2 Region: 41-103
Classification Level Classification E-value
Superfamily GLA-domain 2.75e-25
Family GLA-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 129-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000565
Family EGF-type module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000007509
Sequence length 463
Comment (Xenopus tropicalis)
Sequence
MVAFSSILIIYLLTSLCSTEKAVFLSDESASSLLVRQKRYNTGRLEEWVAGNLERECLEE
KCNYEEAREVFENDDKTKEFWKQYIDGDQCLSNPCLNGGVCKDDVSDYVCWCQQGYSGKN
CELELPVICSIMNGGCDHMCRDDPVKKVICSCASGYKLAENGKTCEAAVPYPCGRVSSPE
ALPKEETRSFLDSLEQNLTSAAHPNITDQEKPKEDIVPVTVDPNVRIVGGTDSLKGEFPW
QVHLVNKDNLGFCSGSIINEKWIVTAAHCFLIRGEFKVVAGEHNTEVSDGTEQHHKVTRI
ILYPAYNATRSKYNNDIALLELEKPLELNDYVRPVCIGNMDFTEKLLKRNAFSMVSGWGD
LGYKGRPAVILQKLAVPYINQAACKKSSRFSIYANMFCAGYSDESKDTCQGDSGGPHVTE
YKNLWFLTGITSWGEKCAEKDKYGVYTRLSRFTDWIRTTTKIS
Download sequence
Identical sequences Q5M8Y0
8364.ENSXETP00000007509 ENSXETP00000007509 gi|56611133|gb|AAH87787| gi|58332150|ref|NP_001011223| ENSXETP00000007509 NP_001011223.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]