SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000016453 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000016453
Domain Number 1 Region: 418-722
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-51
Family Eukaryotic proteases 0.00049
Further Details:      
 
Domain Number 2 Region: 125-241
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-31
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 3 Region: 282-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000107
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 236-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000863
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000016453
Sequence length 722
Comment (Xenopus tropicalis)
Sequence
MALLVWSSLVVASLHLLGTAAYPSRSKYTVINENCPGAEWNIMCRDCCEYDQVECACPDG
NQKVGYTIPCCRNEENECDSCLIHPGCSIFENCKSCNNGSWGGTLDDFYIKGSYCSECRM
GWYGGDCMRCGEVIQAARGEIMLESYPFNARCEWSIQVAPGYTVELRFGMLSLEFDYMCQ
YDYLEVRDGDNVDAKILKRFCGNQRPLSLRSTGNSLHLLFQSDGSKNFDGFYVTFEEVTG
CSSTPCFHDGTCIADKTGSYRCACLAGYTGRHCENVIEEKSCKDPGAPMNGYRKLPDGAG
LSLANHIKVGFKIHYFCNNSYVLSGNQERACLQGAQWSGKQPVCIKACKEPKVADLVRQK
VLPSLVQSRETPLHQLYSASFTKEKTDILPTKKPALPPGELPPGYQHLHTQLQYDCVSPF
YRRTGSSRRTCLKTGKWSGRAPSCIPICGKLENFNITQLGEQRWPWQAALYRRSNGVKDA
SLRKGSWVLVCSGALLNERTVVMAAHCVTDLGKSSIIKVSDMKVVLGKFYRDDDREEKSQ
QHLHISAVIVNPNYDPILLDSDIAVIKLLDKARVSDYVQPVCLTLATEMITSPQEYTIVI
SGWKILSDPRAPGSKNETIRAGAIEPVDSLQCEQQYEENGISVSVTESMFCAKQEPRPSP
SICPSETGGITTVLLPSPTSPEGSWHLIGLVSWGYDKSCRKDLYTGYTKVVTFKEWLEKN
MK
Download sequence
Identical sequences Q6DIV5
8364.ENSXETP00000016453 gi|49522408|gb|AAH75430| gi|52345796|ref|NP_001004944| gi|82183464|sp|Q6DIV5| NP_001004944.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]