SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000025005 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000025005
Domain Number 1 Region: 6-469
Classification Level Classification E-value
Superfamily Sema domain 2.49e-129
Family Sema domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 1313-1440,1636-1825
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-53
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 918-998
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000014
Family Other IPT/TIG domains 0.05
Further Details:      
 
Domain Number 4 Region: 819-913
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000271
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 5 Region: 472-524
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000209
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 999-1102
Classification Level Classification E-value
Superfamily E set domains 0.00000000000042
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 7 Region: 1099-1187
Classification Level Classification E-value
Superfamily E set domains 0.0000000364
Family E-set domains of sugar-utilizing enzymes 0.099
Further Details:      
 
Domain Number 8 Region: 768-801
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000406
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000025005
Sequence length 1855
Comment (Xenopus tropicalis)
Sequence
FTSFYAQHSDWTFNHLVVDVRSGHIYLGAVNRIYKLSEDLKILVTHQTGPSEDNPKCYPP
SIVQPCNDQLVLTNNINKMLLIDYKENRLIACGSLYQGICKLLRLDDLFKLGEPSHKKEH
YLSGVNESGSVFGVIVSHNNLDDKLFIATSVDGKPEYFPTISSRKLTKDSEADGMFAYVF
HDEFVASMIKIPSDTFTIIPDFDIYYIYGFNSGNYVYFLTLQPEMTFPPGSATKEQVYTS
KLVRLCKEDTAFNSYVEVPIGCEKNGVEYRLLQAAYLSKAGSILAKSLGIKPGDDILFTI
FSKGQKRKLNSLDESALCVFVLKDINNRIKERLQSCYKGEGTLDLAWLKVKDIPCGNALI
TIADDFCGLDMNAPLGVSEMVRGLPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKI
RVDGTESGAVQYETIQVVDSGPILRDMAFTKNEEQLFIMSDKQLTRVPVELCGQYTTCSE
CLGSGDPHCGWCVLHNTCTRKERCERSHEPRRFASEMKQCVRLTVHPNNISVSQYNVLLV
LEAYNVPELSAGVNCTFEDLSEMDGLVVGNQIRCISPAEKEVPRIITENGDHLVQLQLKS
KETGMTFASTNFVFYNCSVHNSCLSCVESPYQCHWCKYRHVCTHDPRTCSFQEGRVKMPE
ECPQLLQTEKILIPVDVVKPITLKAKNLPQPQSGQKGYECVLNIQGNEQRVPALRFNSSS
VQCQNTSYSYEGMEIDSLPVELTVVWNGDFSIDNPALNKVHLYKCGAKRPSCGLCLKADA
DFQCGWCAAESKCTLKQHCLPLESQWLELSGTHGKCANPRITQITPVTGPREGGTKVTIR
GENLGLEFWEIENDVKVAEVKCTPLIEEYIPAEQIVCEIGDAKPSQHAGFVDVCVGICRP
RYMAKSSLLYYFVTLSLSRLEPSQGPVSGGTQVTISGTNLSAGSSVKVMFGAQPCIFDRR
TATEIFCNTTASPNLGKVKVTVQIDKAKIAQELLFEYVEDPKIIKMEPEWSIVSGNTPIS
VWGTNLDIIRNPRIRAKLGGKEHINNCTVLNSTEMTCQAPALAINSNHQNEFIERPEEFG
FILDNVQALLVLNKTNFTYYPDPVFESFTPSGILELKPGTPIILKGRNLMPPVAGGNMKL
KYSVFVGDKPCTVTVSDVQLLCESPNLTGRHKVMARVGGMEFSPGMVYITPDSPLSLPAI
VSIAAAGGLLIIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTD
IHELTSDLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLI
NNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLSDLIDKNLES
KNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITG
EARYSLSEDKLIRQQIDYKTLVLNCVNPDNVNSPMIPVKILNCDTITQVKEKILDAIFKN
LPCSLRPKAADMDLEWRQTNGARMILQDEDTTTKIENDWKRLNVIVHYQVLDGSVVALVS
KQVTAYNAANNSTVSRTSASRYENMIKYTGSPDSLRSRTPMITPDLESGVKVWHLVKNHE
HGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDF
LDEQADKHGIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFM
DSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIAKMPAISDQDMNAYLAEQSRM
HMNEFNTMSALSEIYSYVGKYSEEILTALDQDDQAGKQKLAYKLEQVIALMSIDS
Download sequence
Identical sequences 8364.ENSXETP00000025005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]