SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000036622 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000036622
Domain Number 1 Region: 289-546
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-81
Family Eukaryotic proteases 0.000000112
Further Details:      
 
Domain Number 2 Region: 97-203
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 3 Region: 205-295
Classification Level Classification E-value
Superfamily Kringle-like 5.61e-28
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 4 Region: 30-75
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000223
Family Fibronectin type I module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000036622
Sequence length 547
Comment (Xenopus tropicalis)
Sequence
MMFLFIMFLAGVVSSSHEGFHPRWKRGTRSYKSLCVERSSGRIYKLGDTWLRPAGKRTEF
CRCDNGLSRCHSVPVTDCAEQKCYNGGRCQQAVYSTHHLCRCPSGFKGEHCETDTKETCY
EGNGATYRGTQHETHSGAVCINWNSESLSGQRYKAKHKDALSLGLGNHNYCRNPDGDSKP
WCHIFKDGRYKWEYCTLKPCNASLSCYSGRGTTYRGNHNIAMSGAACLRWDSPLVRHRTY
TAWKSQARSLGMGSHNYCRNPDNDSRPWCHIMKGSETAWEYCDVPQCSTCGTRRPQVPQF
KIKGGRGTQITSHPWQAAIFYVSRRFAGEHFLCGGTLIHSCWVLSAAHCFNEISNAEQLR
VILGRTMQREPGDEEQKFTVEQLYVHSEFDANTFDNDIALLKLYSTSGSCAKETESTRPA
CIPDSGLTLPDWTECEISGYGKHEELALLYSEQLKEGHVRLYPDSMCTPERLSNQEVTQN
MLCAGDTRNLDDACKGDSGGPLVCPHEGRMHLMGIVSWGIGCGKKDTPGVYTRVTRYTNW
IREHTGI
Download sequence
Identical sequences Q5BKN3
8364.ENSXETP00000036622 gi|60552029|gb|AAH91010| gi|71896209|ref|NP_001025574|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]