SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000037686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000037686
Domain Number 1 Region: 23-312
Classification Level Classification E-value
Superfamily L domain-like 5.36e-54
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 406-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000037686
Sequence length 661
Comment (Xenopus tropicalis)
Sequence
MWHLLVWIILLATAQQMITEGCPAGCQCNTPQTVFCLARKNSNFPRSVPPDTLNLYVFEN
GISSIEESSFIGLNGLHLLDLSHNQLSSLPGGVFRNLANLSNLDLTSNQLTEISADTFQG
LSRLERLYLNGNRIRSIHPEAFKGIESLLELKLSNNQLVTPPAFSLPHLLLLDLSYNAIP
VIQQGVFNAGNIESLRLAGLGLKEVPEELLSGLKNLHELDLSDNQLDKVPPGLHGLTKLN
IAGNVGFSQIQVDDLSNLPALQELDLSGLSLQTLPKGLFRSSKRLRAVSLAQNPFNCVCS
LGWLSEWMRVSGVVLLRPDETRCHFPPKNAGKTLRQLRDSEYGCPAPTTIQMPSTMPPST
TTGPPTTTKHLQTEAPTTASTTTTTIPHQEQEEDTQPFQFDFEDTLCPPQTCLNGGSCHL
DPTGQLECECPPGFQGTYCETGPVTPAVVTEMYIEQVKIIEVTVSSIRVDLQSYSQNKEK
LRAIRLTVRNLYGADRRPMIYKLPPTLPEYTVRALSSNSSYWVCLGSQGEGGPEEDLCTE
THTLGEPPKHSPQVTQSQEGNLTLVLVPAVAAGILLSAAVAAAACYARRRKGKGHSVEDG
GPLEMDGVKKGLDGKGEVKKLSEDPTGPEKTGAESEEPLMDSTRIGNNNDAPTGRLPHSY
F
Download sequence
Identical sequences Q6DF55
gi|49899857|gb|AAH76888| gi|52345978|ref|NP_001005036| gi|82182797|sp|Q6DF55| ENSXETP00000037686 ENSXETP00000037686 NP_001005036.1.99540 8364.ENSXETP00000037686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]