SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000038482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000038482
Domain Number 1 Region: 872-1001,1215-1403
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.81e-50
Family p120GAP domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 471-560
Classification Level Classification E-value
Superfamily E set domains 1.52e-16
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 3 Region: 559-664
Classification Level Classification E-value
Superfamily E set domains 0.00000000000007
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.082
Further Details:      
 
Domain Number 4 Region: 29-79
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000719
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 5 Region: 378-472
Classification Level Classification E-value
Superfamily E set domains 0.00000000000311
Family Other IPT/TIG domains 0.0085
Further Details:      
 
Domain Number 6 Region: 661-742
Classification Level Classification E-value
Superfamily E set domains 0.0000000588
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 7 Region: 2-33
Classification Level Classification E-value
Superfamily Sema domain 0.0000432
Family Sema domain 0.016
Further Details:      
 
Domain Number 8 Region: 329-362
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000471
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000038482
Sequence length 1434
Comment (Xenopus tropicalis)
Sequence
LLRDMAFSTDNKYLYVMSERQVSRVEVEHCEQYSSCEECLSSGDPHCGWCVLHNTCSRKD
KCERAHEPFRFADNMKQCVKVDVQPNSLPVSEHSLLLTLKVSNVPDLSAGVTCAFGDLKQ
EEGQVQSGSRIDCVSPAAKDIPTMLAAQDWFGVELQLISKETGKTFVSTNFKFYNCSAHQ
HCLSCVNGDFRCHWCKYRNLCTHDPTSCSFQEGRVNVSEDCPQLVPSEEILIPVGEVRPI
TLKARNLPQPQSGQRGYECVLNIQGVVHRMPALRFNSSSVQCQNSSYIYEGMDVSDLPVD
FSVVWNGNFTIDNPQLIKVHLYKCAALRESCGLCLKADHKYECGWCNGEGRCTLHHHCMS
PQNQWLDWSSRNVKCINPRIHEILTVSGPPEGGTRVTIRGANLGLNFSEIAQNVVVAGVQ
CTPVEEEYIIAEQIVCEMGQASPTSSSGPVLLCIEECKPEFMARSLQQYTFVSPTVAHLS
PSRGPESGGTMITITGHNLAAGSIVSVTLGNQTCEYYGRSLNEIVCVTAPSTHGLGPVHV
SVSVDRAQLESNLQFEYIDDPKVLRIEPEWSIASHSGHTSLTVIGTNLDIIQQPRIRVKS
NGKESVNVCKVVNATCLTCLAPALTLEYRPGLDSVERPNEFGFIFNNVQSLLVFNNTKFI
YYPNPTFELLSPNGVLEQKPGSPIILKGRNLCPPATGGAKLSYTVLIGKTPCAVTVSETQ
LLCESPNLTGQHKVTVYVGGMVFSPGSINVIPDSLLTLPAIVSIAAGGSLLLIIVIIVLI
AYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPHLDYR
TYAMRVLFPGIEDHPVLQELEVQGNRQQSVEKALKLFAQLINNKVFLLTFIRTLELQRSF
SMRDRGNVASLIMTALQGKLEYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKML
TNWFAFLLHKFLKECAGEPLFMLHCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIEYK
TLVSTPKTALYSSSLAGGKQILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNV
PYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPK
QTSSYNIPASASISRTSISRYDSTFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHEH
GDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFL
DEQADRHGIYDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMD
SCSTSEHRLGKDSPSNKLLYAKDIPNYKNWVERYYADIAKLPAISDQDMNAYLAEQSRMH
AAEFNIMSALNEIYSYVSKYSVELITALEQDEQGRRHRLAYKVEQLIGAMSFDS
Download sequence
Identical sequences 8364.ENSXETP00000038482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]