SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000040366 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000040366
Domain Number 1 Region: 35-502
Classification Level Classification E-value
Superfamily Sema domain 3.01e-133
Family Sema domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 1346-1472,1686-1875
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.51e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1035-1139
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000478
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.037
Further Details:      
 
Domain Number 4 Region: 851-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000292
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 948-1037
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 6 Region: 505-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000772
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1155-1227
Classification Level Classification E-value
Superfamily E set domains 0.0000011
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 805-839
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000040366
Sequence length 1905
Comment (Xenopus tropicalis)
Sequence
MLLHAEKPLPFHLWTFLVLLGSWIAAGDGTPKSFRTFTGTDWSLTHLVVHNKTGEVYLGA
INRIYKLSNNLTLMRTHVTGPVEDNEKCYPPPSVQSCPHGLVSTNNVNKLLLIDYSENRL
IACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVPNGQNKLFVGT
PIDGKSEYFPTLSSRKLMGNEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYVYS
FSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCIKDGVEY
RLIQDAYLSKPGKRLAKELGISEREDILFTVFSQGQKNRIKPPKESVMCLFTLKKIKDKI
KERIQSCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTPLFLD
KEDGMTSVAAYDYRGHTVVFAGTRSGRMKKILVDLSASSHMAQQYENVVVHEGNAILRDL
VLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERA
DELHRFTSDQRQCVQLTVHPRNISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGRI
LDGKIYCTSPSTKDVIPITRGHGKERWVLKLYLKSKETGKKFASVDFVFYNCSVHQSCLS
CVNGSFPCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPSTQIYIPVGVVKPITLTA
KNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSVSVSGDGCLQLPVNLTKS
LLVHILLTTVFSPAAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENP
WMHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRFEDIRFGVRVGHVMCVPI
ENEYISAEQIVCEIKDAGKMRVHEAQVEVCVKDCSQDYRAISPKSFTFVVPSFNRVTPSR
GPLSGGTWISIEGSYLNSGSDVSVDIGGRPCMFSWRTAKEIRCKTPQGPSTGKAEIQIHI
NRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKIRAKYGDAER
ENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDP
VFEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIGDTPCALTVSETQLLCES
PNLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRK
SRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMR
VLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVA
SLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLY
KFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLNPCADDV
GLSDESCCRSPQTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKA
GDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNIS
NSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRG
SKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQI
TDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKL
GKDSPSNKLLYAKDIPNYKSWVERYYADIAKMSVISDQDMSAYLAEQSRLHLSQFNSMSA
LHEIYSYITKYRDEILTALEKDEQARRQRLRSKLEQVIDTMAQSS
Download sequence
Identical sequences 8364.ENSXETP00000040366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]