SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000003395 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000003395
Domain Number 1 Region: 256-512
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-54
Family Nuclear receptor ligand-binding domain 0.000000669
Further Details:      
 
Domain Number 2 Region: 131-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-27
Family Nuclear receptor 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000003395
Sequence length 513
Comment (Gallus gallus)
Sequence
LTNRQQTQEQNMANTFVTVPDGYCLAEPIQYYDVLPEHINYQLQDTDFQTAPYYQYSSAQ
IPSPVLQSQPSQSHYSAYSLDSQYTDGQYIISNCELSKPPFTASHLDDSGFQALKRPRLN
HSSLRLKGQEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYRCKNGGHCEMDMY
MRRKCQECRLKKCRAVGMLAECLLTEVQCKSKRLRKNFKQKSSFLCNIKLEDEGVNSKHV
SSTTRSGKTVEKVELTPGEHQLLDHIVAAHQKYTIPLEEARKFLQETTSPEESFLHLSET
AVVHVQVLVDFTKRLPGFESLASEDQIALLKGSTVEAMLLCSAQIYNQRISECQSSSESH
IRRSDHTTCCHVPNLDKNMYSIQMSHSEESPTSTTTTGITEEFITALFYFYRSMGELKVT
ETEYALLVATTVLFSDRPLLRNKRHVEELQEPFLGILYKYSKIHHPEDPQHFARLIGRLT
QLRTLNHTHAEVLVTWRTKDPRLTALLCEVWEL
Download sequence
Identical sequences ENSGALP00000003395 ENSGALP00000003395 9031.ENSGALP00000003395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]