SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000003681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000003681
Domain Number 1 Region: 117-417,455-509,552-607
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.22e-67
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 
Domain Number 2 Region: 609-724
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000398
Family Motor proteins 0.046
Further Details:      
 
Domain Number 3 Region: 861-959
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000011
Family Motor proteins 0.045
Further Details:      
 
Domain Number 4 Region: 1866-1939
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000292
Family Motor proteins 0.022
Further Details:      
 
Domain Number 5 Region: 1798-1871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000112
Family Motor proteins 0.031
Further Details:      
 
Domain Number 6 Region: 1284-1362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000195
Family Motor proteins 0.023
Further Details:      
 
Domain Number 7 Region: 1504-1574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000242
Family Motor proteins 0.049
Further Details:      
 
Domain Number 8 Region: 1362-1427
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000366
Family Motor proteins 0.017
Further Details:      
 
Domain Number 9 Region: 1725-1796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000425
Family Motor proteins 0.042
Further Details:      
 
Domain Number 10 Region: 1138-1215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000425
Family Motor proteins 0.024
Further Details:      
 
Domain Number 11 Region: 1650-1727
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000114
Family Motor proteins 0.042
Further Details:      
 
Domain Number 12 Region: 958-1053
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000345
Family Motor proteins 0.028
Further Details:      
 
Domain Number 13 Region: 1580-1649
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000398
Family Motor proteins 0.049
Further Details:      
 
Domain Number 14 Region: 1217-1289
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000151
Family Motor proteins 0.078
Further Details:      
 
Domain Number 15 Region: 1426-1510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000319
Family Motor proteins 0.035
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000003681
Domain Number - Region: 792-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000266
Family Motor proteins 0.035
Further Details:      
 
Domain Number - Region: 1944-2006
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000664
Family Motor proteins 0.026
Further Details:      
 
Domain Number - Region: 1063-1134
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00234
Family Motor proteins 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000003681
Sequence length 2006
Comment (Gallus gallus)
Sequence
VNRINKPIAGLAQSHLTFVKPLKTVIPRHPMPFAAKNMFYDERWKEKQQRGFTWWLNFVL
TPDDFSVKTNTSQVNAAALLLGEENHHKTSVPKAPTKEEASLKAYTARRRLNKLRRDACR
LFTSETMVKAIKKLEVEIETRRLLVRRDRHLWKDVGERQKVLNWLLSFNPLWLRIGLETV
YGELITLESNSDFIGLAVFILNRLLWNPDIAAEYRHPTVPHLYREGHEEALSKFTLKKLL
LLVCFLDRAKQSRLIGHDPCLFCKDAEFKSSKDILLAISRDFLSGEGDLSRHLGFLGLPV
SHIQTPLDEFDFAVTNLAVDLQCGIRLVRAMELLTKDWSLSKQLRVPAISRLQKMHNVNI
VLNVLKERGIHLKDDSGASIDCRDIVDRHRERTLALLWKIVFAFQVDILLNVEQLKEEIK
FLKNAHKIKMQLGALKLFSSCRVQEDSSSSPSPQSHSENVKLLMAWVNAVCGFYNIKVEN
FTVCFSDGRVLCHLIHHYHPCYVPLEAVCQRTTQTVECSRTHKVGLNCSSSSSSESDTSL
NVMEAVTASVLYKELLENEKKNFQLINNAVADLGGIPAMIHVSDMSNTIPDEKVVITYLS
FLCSRLLDLRQETRAARLIQSAWRKYSLKRELKLSQERDRAARIIQKYAINFLSHRRLVK
EHNAAVIIQKHWRRFLARMIFLNLKKTKWEEARSKSATVIQAYWRGYSARKSYLQLRYYV
IFLQARIRMLLSVTAYKRILWATVTIQNRLRASKLAKEHRQRYEILRSSALTIQSAFRKW
RKHKMQEKIRAALVLQRYFRKQQSSKLAKRKRAALVIQSWYRMHRDRKRYLRVQQNIIKI
QAWYRCQIARRIYQEYRAQIVTIQQYYRAYTFGKKERENYLQKRAAAVVLQAAFRGKKAR
ILYRQTKAACVVQSLWRMRQAKLRFLLLKKSATILQSHVRKYQQVKRYKEMKNAARVIQA
WYRAHVASKKAASSFQRMRLAAIVLQSAYRGRKARKEVHVLRSVIKIQSSFRAYVVQKRF
KNLRKATVKIQAHVKMRQARRYYCALREATLYVQQRYRSRRYALQLNEDFRKLKGACIRI
QAAVRGYLVRKQIKSGRETAVLLQAQYRMRRTRXXXFSIYTAAVVIQNRYRAYRRQLCQS
RSSLQVKKAAVCIQAAYRGYKARKMLKLEHRAAVKVQTAFRAHAAKKKYQAMIQASVVIQ
RWYRTCKTRNRQRLAFLMTRAAVLTLQSAFRGYQVRKQIRRRHAAATAIQSAFRKFMALK
MFRLRNRAALTIQRHYRASVISRKQRQYYVELRNCVVHLQAIWRGKTVRRKIQKKHNLAT
IIQSYYRMHVSQLKFKKLRQSTLVIQRYFRAYRMKKNQRALYLKTKAAVLVLQSAYRGMT
ARKQLRELSKAARTIQAAFKSYLVKKDYVRLRSAAVVIQRRYRAVIHANRQRHKYLSLKM
AAIKMQAIYRGVKVRRQIHSMHRAAICIQAMFKMHCINIRYREIRMAVIIIQRQYRAFCL
GRVQRKKYLELRKSSVVLQAAFRGMKVRQDLKRMHRSAALIQSYYRMHKQQRDFRNLLLA
TRRIQQRYRACKERNAQVHNYRIVRSATLRLQAAFRGMKTRRLLRTMNESAELIQRRFRT
FLQRKRFISLRTAAIVIQRKYRATKLAKIQRQKYISLFNAAVIIQSAYRGFVARQKMRQM
HQAATVIQAMLRMRKLYISYQALRLASVSIQQHYRAYREGKSVREMYLKTYNSVLVLQAA
YRGMKTRKQCQEMHRAATVIQKNYRAFREHQRYLSLKAAALVFQRRYRALILSRQHTREY
LYLRGAAIHLQAAYRGMRARKSIERMHVAARTIQSAYKMYRNRRAYQKMRTAAIFIQNYY
RSYVKAKNQQKKYLMIKKSALLIQASYRGMKERQKLKTMRASAVVIQSSYRMYIQHKYYK
QLCWAVRVIQQRFRAKKAKEADMENYAKIRKAIICLQSSFRAKKARQLHKTNAAVLRIQS
FLRMRMERKRFLVKKAAAVTIQSAFR
Download sequence
Identical sequences 9031.ENSGALP00000003681 ENSGALP00000003681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]