SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000003878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000003878
Domain Number 1 Region: 32-301
Classification Level Classification E-value
Superfamily C-type lectin-like 3.28e-89
Family Sulfatase-modifying factor-like 0.00000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000003878
Sequence length 316
Comment (Gallus gallus)
Sequence
FVAGEMRRAAVLCCCVLGCSCALLAFGSNEHMVRLPGGRFQMGSSSTQSRDEEGPIREVT
VKPFAIDKFPVTNRDFREFVREKKYKTEAEAFGWSFVFEDFVSEELKKKITQKLESAPWW
LPVEKAFWRQPAGPGSGIADRLDHPVLHVSWNDAQAFCRWKGKRLPTEEEWEFAARGGLE
QRLYPWGNKFQPNRTNLWQGDFPRGDTAEDGYHGVSPVAAFSPQNSYGLYDLLGNTWEWT
ASQYTPPGPPRPRAEAMHVLRGASWIDTVDGSANHRASITTRMGNTPDSASDNLSFRCAA
DIPNRTTKSSRTKPEL
Download sequence
Identical sequences ENSGALP00000003878 9031.ENSGALP00000003878 ENSGALP00000003878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]