SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000005055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000005055
Domain Number 1 Region: 8-162
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.22e-68
Family TRADD, N-terminal domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-17
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000005055
Sequence length 305
Comment (Gallus gallus)
Sequence
KMAGSSTPWIGSAYLFLQSTCKTIILPNLYESAQKKPCVFKALKLALADSTGSMNGVDVL
KVHCSHPHLIVQLKFCKQENCRRFLQSYREGELQKSLQNHLQLSLAMTTVPLEMELKAGN
EHLDSMLKDEDRCLECIYREKPDRLRDEEITELEERLKSLILHQNINNNMPSKDCMSLNS
PSLPSQGSSLSPQVTFLFQGQQFDNRTLTPDDHQKFAKLVSKKWKQVGRSLQKNCRALRD
PVIDNLAHEYDREGLYEQAYQMLLRFIQSEGKKATIARLIAALEENGLTSLSEELLGLHS
NEDDS
Download sequence
Identical sequences 9031.ENSGALP00000005055 ENSGALP00000005055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]