SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000005876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000005876
Domain Number 1 Region: 303-559
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-82
Family Eukaryotic proteases 0.0000000538
Further Details:      
 
Domain Number 2 Region: 108-213
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-34
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 218-303
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-31
Family Kringle modules 0.0000625
Further Details:      
 
Domain Number 4 Region: 43-87
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000022
Family Fibronectin type I module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000005876
Sequence length 560
Comment (Gallus gallus)
Sequence
MWKTLRMKGKLLSLLLLVGVIKTAQCQGTHMRYKRGARSQVTAICTDYSSGQIYQHRGSW
LRLSGSRIEYCRCDRGWSYCHTVPIRACTRNKCYNGGQCSQAYYSPQLFICRCHHGFSGK
QCEIDTEVKCYKNAGVTYRGTWSITESGAECLNWNINGLMDHKYSGQRKDAAELGLGNHN
YCRNPDEDSRPWCYVYKGGKYTWEYCSVPPCSKVGNINCKTGRGTDYRGSHSVTISGATC
LRWNSQIIVSKLYTAWRRDAYQLGLGSHNFCRNPDNDSKPWCHVLKGKQLTWEYCDVPTC
SSCGLRQHRARQYRIKVGSYADIEAHPWQAAIFVKYYRVPGEHFLCGGILISSCWVLSAA
HCFEEGFSTNQLKIVLGRTSRATPEEKEQKFQVKNYVVHERYDSENYNNDIALLQLNSDT
EDCAIETDTVRAACLPTPDLQLPDWTECEISGYGRNEEFSPFYSEHLKVGHVRLFPASRC
TTQHLHNRTVTDNMLCAGDTRHLDDACKGDSGGPLVCMKDDRMHLIGIISWGIGCGHKGI
PGVYTNVNRYLNWIQNNMKP
Download sequence
Identical sequences ENSGALP00000005876 ENSGALP00000005876 9031.ENSGALP00000005876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]