SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000009486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000009486
Domain Number 1 Region: 51-109
Classification Level Classification E-value
Superfamily RING/U-box 6.12e-18
Family ZZ domain 0.0093
Further Details:      
 
Domain Number 2 Region: 340-388
Classification Level Classification E-value
Superfamily UBA-like 3.57e-16
Family UBA domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1-33
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000017
Family PB1 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000009486
Sequence length 393
Comment (Gallus gallus)
Sequence
LSYPDEDGDLIAFSSDEELDLAMPYVQDGVFRVYIKEKKECRREHRSQCSQEPPRDMVHP
NVICDGCQGPVVGARFKCTVCPDYDLCSTCEGKGIHKEHNMVMFQSPLWYPRGRWLRKMR
HGVPPFPWMHCWGYPGPAAPCQNSEQAQADAAASSPPAAGEASTNSQPQDPNVTFLKNVG
ESVAAFLSPLGIEVDIDVEHGGQRSKVTPASPNQENNNAESSSSTLNQNSQTKPYWSNTE
SATVVNTVAEQIQDMVIDPVPTQMEDGSLQSQEHSESSSSSGGDEDWTHLSSKEVDPSTG
ELQSLQMPETDDPSSLDVAQEAPQAGPTGLREAALYPHLPPEADPRLIESLSQMLSMGFS
DEGGWLTRLLQTKNCDIGAALDAIQYSKQPPSL
Download sequence
Identical sequences ENSGALP00000009486 9031.ENSGALP00000009486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]