SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000013774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000013774
Domain Number 1 Region: 493-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7e-57
Family Eukaryotic proteases 0.0000000406
Further Details:      
 
Domain Number 2 Region: 109-207
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-36
Family Kringle modules 0.0000122
Further Details:      
 
Domain Number 3 Region: 297-381
Classification Level Classification E-value
Superfamily Kringle-like 4.83e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 206-288
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 5 Region: 376-474
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-26
Family Kringle modules 0.00058
Further Details:      
 
Domain Number 6 Region: 32-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.02e-24
Family Hairpin loop containing domain 0.0000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000013774
Sequence length 726
Comment (Gallus gallus)
Sequence
MWATQLLPALLLHQLLLPPITIPAAEGKGKRRNPLHDYKKTGELMLIKVNKTLEVKTKLL
NTTEQCAKRCSRNKGLSFTCKAFAYDRVTKRCHWLSFNSLTNGVRKKQDHAFDLFEKKDY
VRNCIIGKGAEYKGTISITKSGIQCQAWNSMIPHEHSFLPSSYRGKDLRENYCRNPRGEE
GGPWCFTTSPQMRHEVCDIPLCSEVECMTCNGESYRGPMDHTESGKECQRWDLQRPHKHK
FRPERYPDKGFDDNYCRNPDGKLRPWCYTLDPNTPWEFCAIKTCDVGILNSTEAVAETTT
CIQGQGEGYRGTVNTIWSGIQCQRWDSQFPHQHNITPENFKCKDLRENYCRNPDGSESPW
CFTTDPNIRIGYCSQIPKCDVSNEQDCYRGNGKSYMGNLSKTRFGLTCSTWDKNIEDLRR
HIQIFREPDVSKLKKNYCRNPDDDFHGPWCYTDDPLIPWDYCPISRCTGDTTPTTTSLDD
TVIPCASTKHLRVVNGIPTQTNEGWVVSLTYRNKHICGGTLVKEEWVLTARQCFPSRYKD
LKDYKAWLGVHNIKGKGEEKHRQVRNISQLVYGPAGSDLVLLKLSRPAILTNFVEIIRLP
ISGCTIPEKTSCSVFGWGYTGLPNYDGLLRVANLFILGNEKCNQYLKGKITVNESEICAV
AETIGAGPCERDYGGPLVCEQNRLKIVVGVIVPGRGCAIRNRPGIFVRVSYYSRWIHKIM
MTYRKP
Download sequence
Identical sequences A0A1D5PAR6
ENSGALP00000038999 NP_001025541.2.86415 ENSGALP00000039002 9031.ENSGALP00000013774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]