SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000016973 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000016973
Domain Number 1 Region: 8-413
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-93
Family Ras GEF 0.00052
Further Details:      
 
Domain Number 2 Region: 486-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00092
Further Details:      
 
Domain Number 3 Region: 418-497
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000269
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000016973
Sequence length 692
Comment (Gallus gallus)
Sequence
MGSNTLGKAATLDELLNTCIEMFDDGENQCSSHLPRIFLLMHRWYLPSTELAVKLLNTYR
DASGENCNEFRLKICYFMRYWILEFPAEFNLDLGLIRLTEEFRELASQLGYEDHIDLIDI
SSIPSYDWMRRVTQRKKISKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPLQRAEVITKFINVAQKLLHLQNFNT
LMAVVGGLSHSSISRLKETHSHLSSEVTKDWNEMTELVSSNGNYCNYRKAFADCVGFKIP
ILGVHLKDLIAVHVIFPDWIDENKVNIVKMQQLSITLNELVSLQTASHHLEPNMDLINLL
TLSLDLYHVSDDISYSGSLMLPSSSVKQPTSPTTPSKPVVPLEWASGVVPKPDPTVINKH
IRKLVDSVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKEEMMAYFLR
AKSQFQCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCRDLL
VLACRKFSRGTSVGSNHGSLPSSPSLPPAQDEVFEFPSVDAEHQDLDGRAITLVTGSSRK
ISVRLQRATASQATQTEPLWHEPGWSDSGSHTFPKMKSKFHGKAGKNKGFAKWENEKPSM
QADVGIDAEAPQHILEHNGIETLPERQESEDS
Download sequence
Identical sequences 9031.ENSGALP00000016973 ENSGALP00000016973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]