SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000017430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000017430
Domain Number 1 Region: 719-751
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000324
Family EGF-type module 0.017
Further Details:      
 
Domain Number 2 Region: 623-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000342
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000017430
Domain Number - Region: 441-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000157
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 687-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000466
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 591-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 478-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00186
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 751-782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 656-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00373
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 785-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0058
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000017430
Sequence length 828
Comment (Gallus gallus)
Sequence
KSQSVTSRRKRQSYYEYHPVFLFQSLSQRDLEGYRYFFPEDHTTGEDKKFLPSWPTPSGL
TESSALRLCQQAIANSSIGRACGGLLGRRMQDAINICVKDLLLKDDLRWAEASLALLENE
CEKRVLEEINYNQQELQGFVENMLIALKCPSLCSGNGECTEWGCACFQGYGSYDCSILSD
QAPEITELENAGLCDIRQYDCTSVRAFGHGFRESSNLKCEIIRLQYTDSQWIPGEPLITS
AAFQNVRTVDCELPNNGPQPDVVDLVDDKPIAWWKIKISNDGLTYSNAKTMIIYDGACQI
CELQESGLCALKEKTCNIDGLCYGEGDTNPISPCLLCRPDTSRLTWSVVENNQPPVLETF
QGMLQTFYGEDFVYQFLASDPEGSAILFTLESGPEGASLSPSGLLLWKAVSKNPRKLTFS
LTDDCNAETKVEIEVRVNSCDCLNNGSCVTNINFPPGSGRYLCVCVAGFEGDLCQVNTDD
CKLNRCGTGKCVDGVNSYYCECPPELQDVLKYFDKLERIKVILFHQDSEISDSHTDKNIA
GKKHHYSNLVGMALFYTICRQTCGKNMECVAPNICKCKPGYAGYNCQTALCRPDCKNHGK
CIKPNVCECLPGYSGSTCEEAYCKPSCKNGGTCLARNLCTCPYGFVGPRCDTMLISGHCE
NGGECLTPDICQCKSGWYGPTCSTAMCDPVCLNGGSCTKPGVCLCPHGFYGARCQNAVCR
PPCKNGGHCMRNNICTCPEGYTGRRCEKSVCEPTCMNGGRCVGPNVCSCPSGWSGKKCNT
PVCLQECKNGGECIGPSTCHCPPQWEGIQCQTPVCNQKCLFGGKCVSP
Download sequence
Identical sequences ENSGALP00000017430 9031.ENSGALP00000017430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]