SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000018485 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000018485
Domain Number 1 Region: 863-1077
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-53
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 1240-1426
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-26
Family Pleckstrin-homology domain (PH domain) 0.0000135
Further Details:      
 
Domain Number 3 Region: 1066-1186
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000018485
Sequence length 1430
Comment (Gallus gallus)
Sequence
FPSFLEIKKPPVAPKPKFVVGHKATPPPVAPKPDVVLSGVLQAARKTKPAIAPKPKVLKS
SSIPEVKPPSCARKGTKSFEEHRGDSSQTLDHLNYKNEVSEGSTDNTAYILPMSSCKFEC
LHKLGNGENTCKTQIILEHFENLENIKVDEKTALSLGSSPSEKMANRNQVVVKASILEEK
LKDVLTHGVFPNRSPVRHRYADRLYKGDGNSSTNDVKIEFMELVQSSSSEVANGRQQNTG
SKLTEDEFQTSETCPSLNENHSSFSCLLNQEILENENVNSSSSFSGEMGMKIDTALSSKM
LPIPKPRKPRAACLVRQDGIDSVGEGTKEPSSSENDSFGPAEHSFKKPAKINVLGQSVCY
NNHTEALNPEKSEITQSIADRMHLRKEPADTEESTLQNLLPQLSHKTSDLVENVECPLDT
DHNLSSSVDRMTDDASMPDTVDKRTSFIRCDALSMSLPKQIKLPVSQHLPAANSLHVSLQ
KVEDREAKIKDESSPKIVPKKPQRHSLPAAGVLKKAASAELVEKSSYTSSEDKSNSVLEG
SHFSHSPAREQGALSSSDIPRRSSEKPVWKLPHPILPFSGNSESLKTASIAPSFSHVSAV
TKPRAKSLSSVDMERTDKPCKDTQKKNSLKKFLNVKLSVCLMKSDFQKLLSKGSQSMDSS
TANLSTGEGYGNGNSRHVASVGSERKAKSAKARSVEISSPALQKKRQRNRSQPEMRSNQR
LESLDGHSLPGENLSQMHLNSVTSNCAPEYENLRHYEEIPEYENLPFAMGAGKNLCLEWQ
NSSRVEDPSSSLYEVEEPFQAASRRVRHGRLFSALAQETKERLLFGLSDDPDDEDIVNSS
DEDDDTNSDSSKGEPDSQDQLQSKAAGKKTKVYHIAKEIMSSEKVFVDVLKLLHIDFRDA
VAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLRELEERLSHWLEHQRIADIFVKKG
PYLKMYSTYIKEFDKNIALLDEQCKKNAGFASVVKDFEMSPRCASLALKHYLLKPVQRIP
QYRLLLTDYLKNLLEESADYRDTQDALAVVIEVANHANDIMKQGDNFQKLMQIQYSLNGH
HEIVQPGRIFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKV
KKPSQEAYQNELNIESVERSFILSASSATERDEWLEAISRSIEDYAKKRITFNPSKSLEE
ADTEKREEASPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKH
GLDYMKNQPARVCDHCFRELQKQDNQCSPKTGSPVNHKSPSSALSTVLHSIPSGRKQKKI
PAALKEVSANTEDSTMSGYLHRSKGSKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLL
GFTVSEVRDENSESRVFHLLHKNTLFYIFKADDPHSAQKWIEAFQEGTVL
Download sequence
Identical sequences 9031.ENSGALP00000018485 ENSGALP00000018485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]