SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000025970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000025970
Domain Number 1 Region: 700-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 784-839
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000824
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 371-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000426
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 537-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000919
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 459-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000832
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 627-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000525
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 7 Region: 745-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000558
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 829-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000618
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000025970
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.000111
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 430-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00628
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 194-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00921
Family Classic zinc finger, C2H2 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000025970
Sequence length 1141
Comment (Gallus gallus)
Sequence
MAEDGSDETMFVWCEDCGQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGT
EGVFALTQLVKRTQFGPFESKRVAKLEKETVFPLKVFQKDGPLLYFDTSNEDDCNWMMMV
RPATEHEHQNLTAFQHDNDIYFTTSRDIPPGTELRVWYAAFYAKKMEKPVLKQAFSQLHM
CSTPEGGGAAETEPSQWTCKVCSSAFQEPQLLTEHLMSHLEQAKCAPQTGQNEAAAEKVT
EAPPADPPVVCDAASASTDSRRKARRGRKIKTAKAETEAPLVAAEEKDPAVERVADTAAE
VPPEEVALPSAAEERIMELVLGKMPSTTNSISSVTKFAHHQNSMSLKRSLILSSRHGIRR
KLIKQLGEHKRVYQCSICSKIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVS
YKHSRNEVDSEYRYKCTTCEKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHK
KKHGDKKFACEICNKMFYRKDVMLDHQRRHLEGVRRVKREDFEHSTENMVRYKKEPSGCP
VCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREE
FIGKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMDVHKEKGYGCSIC
NRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHA
CEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKEC
HRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKY
VTDYMLQKHIQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEILSVKIDDLEQLPET
TTIDASSIGIVQPELALEQGELPEGKQHMKAPKRGQKRKQKSGEEEETQVPEDSAFSEYT
EKEAEFTGNVGDETNSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTAAGTQFTN
LQPVAVGHLTAPERQLQLDNSILTVTFDTVSGSAMLHNRQNDIQIQPQPEAANPHSVAHF
INLTTLVNSIAPLGNQITEQHPLTWRSVPQTDVLQPPAQPAQQQSGQQQVQAEQQQQMYS
Y
Download sequence
Identical sequences ENSGALP00000025970 9031.ENSGALP00000025970 ENSGALP00000025970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]