SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000027362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000027362
Domain Number 1 Region: 62-203
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-32
Family C-type lectin domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000027362
Sequence length 211
Comment (Gallus gallus)
Sequence
MTHLFLFLLFGALALSGSEGAGNSTARHRNARFLFDFFGRLNPEHNIIPNPSQQDSSARQ
ICRSRCQKGWISYKDHCYMLIQERMTWLEAEKTCSAKSAGGHLTSITSAEQNEFLRKLSQ
GQQNTQFWTGGTYLKGSSLKWSDGSLITFVQRPLSSIFHAVGGLINSLLNIKLCLMVNIG
GGAQWDSSPCGQKLPFICTYKPSLVQLSLNH
Download sequence
Identical sequences A0A1L1RV99
ENSGALP00000027362 9031.ENSGALP00000027362 ENSGALP00000027362 XP_417032.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]