SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000032471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000032471
Domain Number 1 Region: 361-498
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-33
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 2 Region: 220-352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-32
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 3 Region: 1244-1377
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-29
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 4 Region: 811-936
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-29
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 5 Region: 506-643
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-28
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 6 Region: 1114-1234
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-28
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 7 Region: 652-797
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-26
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 8 Region: 952-1097
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-23
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 9 Region: 36-161
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.45e-23
Family Cysteine rich domain 0.017
Further Details:      
 
Domain Number 10 Region: 161-216
Classification Level Classification E-value
Superfamily Kringle-like 1.34e-17
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000032471
Sequence length 1459
Comment (Gallus gallus)
Sequence
MLGVLLLACCLLLGGRSLPRGDAALSRDELPSLRNKGIFIIQSSGSNLCIKADTAGLVLE
DCSQLSKHMLWKWVSNRRLFNIGRSSCLGLNISRPEQPLTMLECDSNRYSLWWNCDGRAL
VGVSEYRLAVENSKRIVAKKKSDYQWIQYMSYDEDLCEHPFQETYTLLGNSFGFPCVFPF
KYNNKWYYECTRDGKEFEWCATTSYYEQDEKWGFCPGVEHGCGTFWKENPATHVCYQFNP
SAVLSWHEARAACQAQGGDLLSITSPEEQSYLSNLSRQLNTTDAVLWTGLNRLEEGAGWQ
WSDGAPLVFVNWKADVSEDHSSENHCAVMSSKLKYGWKSYLCESGLPFVCKKYLNKIEQE
TLDTWKYYATRCDAGWYPYNRYCYRLHKEAKSWNDALISCQSDNSGLISISSMADAELLH
NLLQRENITETWIGLYSSNISVVFEWSDGTPVKFSYWHSQEPNTFQRTGQLCVSAQGPEG
LWKVKKCEDKSFYICKKAGEFNSVSSDAESSCPEGWERHGGYCYKIDSTPRSFEHASSGY
FCPSALVSVTNRFEQAFITSMIRSVVKSERTYFWIGLQDLNNTGEYVWLTKDGKNHSVSY
TNWNKHQPRHSGGCVAMRGQDPVGYWEVKSCKNFKAMSLCKQKISSYEEPELTFQRHLSS
CYFGWESEGNLLNCYKIFHREKILMKRTWSEAETLCQDFGAHLASFSHVYEETFLNNLLY
TIFDRTEERQFWIGFNRRNPFSGGTWQWSDRTPVVASFLESKYVEDDSRNCGVFKVNRTI
FPAHCNEKREWICKIPKGVKPKNPDWYIAELPWSYYQGAEYLFHVNPTDWDTYEFICVWL
RSEMATIHSADEQAFIENKIKKLSDSDVHWWIGLHAESISNEFRWKDGSQITYQNWNEGR
DRYLRKPGKRCGFISSQTGRWDDENCTVSLPCICKRKSAWKIEKEIPKDQNPQGTCPKGW
LHFGYKCFLIQIPKDPEHLRSWYSAQTFCSRYDGSLASLEDELEQAFITMNLFGRKTSVW
IAFQGDDYEKWMNENPPRYSNWSPIEAVHRPRYNGVYVEEQVPLCTLVSNNPNFYFTGKW
YLENCEKNYGFVCQKGQDTSRHIVNASEMYPVPDTLQYANRTYTLIRGNFTWSAALKACM
ANGAELVSIADQYHQSFLTIIVNRLGYNHWIGLFTADNGLNFEWSDGTRSLFTFWEDDES
QALGSCVYMDTSGRWKSTSCERLLPGAVCHVPPKKKLTEYKGLCSENNVPWIKFKNSCYS
FNTVLQGTSFDTAYEVCRNQGSNLLTIKDEDENAFILEELHSFGYSVKMVWLNILQVTDN
ETVSWFDGSPLNYSNWGIREPEFDHLKGNFCISLRTADGVWQISPCREIKGFVCKKDADL
DAAEPSKKQSYPGLAALAVFVTLVMLAAISFFLWCLYKQNNRFFHRILWVRNAYFPQINS
DVPALEESILISDFERDDN
Download sequence
Identical sequences E1C5Y7
ENSGALP00000032471 9031.ENSGALP00000032471 ENSGALP00000018160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]