SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000003426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000003426
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.24e-40
Family SCAN domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 544-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 227-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000523
Family KRAB domain (Kruppel-associated box) 0.0047
Further Details:      
 
Domain Number 6 Region: 586-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000561
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000003426
Sequence length 619
Comment (Ornithorhynchus anatinus)
Sequence
MAAAVGLPVQSPLEQEEILIVKVEEDFSWGEETSPQGDDPSPETFRQLFRLFCYQEVAGP
REALSRLRELCCRWLRPEVRTKEQILELLVLEQFLTILPGDIQTWVREQDPESGEEVVVL
VEGLHREPRRQRQRVTVRVQGQEVVAEEPAPRGGPREARRFQVEPLLQEEEGAQDPHPGP
LPQQQQLNHRPRREPQLRPKRGEALGCLGLAGPRSEALDHKLTGPRFLQTPVMLEEVAVY
LSQEEWERLDPAQRDRYRDVLQDNYGVEGETGLPQRLETFGLGCLDTELVGGVGPPKVTY
LLFEGPIEIAPVRSRGRLSSLPSSRATSSFALHPSILLPSPIPAPGEPDIKRNYCVHCCG
DEGGVYKVCKGDTEGRGSRRNEGLVGSPLRVCLILTDSGSSPEMTIQVRRLARAKICQPS
LVVRMETKEGNPKQASSMKVGLHRTLSVEKPYKCLECGKSFNKSSHLIKHQRTHTGEKPY
KCLVCGKGFSDRSNFSTHQRIHTGEKPYKCNECGKCFSQSSSLVIHRRTHTGERPYKCGE
CGKSFNNSSHFSAHRRTHTGEKPYPCHDCGKSFRRGTDLNKHQRTHTGERPYKCHCGKSF
TRKHQLITHQGIHTGEKAF
Download sequence
Identical sequences 9258.ENSOANP00000003426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]