SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000010551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000010551
Domain Number 1 Region: 850-1061
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-52
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 1224-1410
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-25
Family Pleckstrin-homology domain (PH domain) 0.00000676
Further Details:      
 
Domain Number 3 Region: 1050-1171
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-24
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000010551
Sequence length 1414
Comment (Ornithorhynchus anatinus)
Sequence
ILPFLEIKKPPVAPKPKFVVAHKPTPPPIAPKPDVMISSGVQSTKKTKPAIAPKPKVFKD
SPTSDIKLTPARKSTVNFPERSKELFENLENLNCKNGIPGEDVNETYIFCSCTSECTHKT
GTGENVCKAQVVLEHLEKLESLENIEIDEQATKTLRTRRKLDLNREKVTSSHVFVKASLL
EGKPKDVSTHGAPIGCHLNQGAGDSTEEDDNLNPNKQVRIDFYDLVTSPLNFDEDSDKPN
HYSKLVRDEGQGLETCQDWTRDGRHCFCSLDQGVKENGKMNSLKFQGRIRGKAEDNDVSL
LVTPSLRCAKKFPVPKPRKPRPACLVRQGGVDDPDPGEPDNSASDSFSFAEHCMKKTNES
NIPGQNILYHSPHGEKGNQANHHSGDEGSQSQASLEKHYFTPQKCPKPPYPVEKMEFSVV
TDCNPRLENKTLDGSSMLPDVDTLSLSLHKRLLPTNNQHVLPASSSDVPAQKTDKEIHVR
VESSPKIAPKKPQRHSLPAAGLLKKAASEELMEKSSYPSNEERNSGGILEETCLRHLSTK
DMPKRASEKPVWKLPHPILPFSGSPESLKSVRMPLANLPLTSLSKPRAKSMSSVDIERTE
KPCKNSQKKSTLKRLLNMKLSLCIMKSDLKKLLSKGSQSVDSVPGDLLCGEGKRIHNDQH
GPTLVNEKKIKSLKAYSADCPALKMKSQRPLEVPDSQRAESLDDQMLSRETSSQLPLSSL
KDSCAPEYENVRHYEEIPEYENLPFIETTGKALSFEWQNSSSVENSDTTVCVLEELYEDS
DSQLNHGLHHLSFSSLAPHEDHDSLGVVSSDFPSDDEEIIDSSDEDDASSDSSKGEVDLL
DDKQGKGAGKKNKAHHIAKEIMSSEKVFVDVLKLLHIDFRDAVAHASRQLGKPVIEDRFL
NQILYYLPQLYELNRDLLKELEERMLNWMEQQRIADIFVKKGPYLKMYSTYIKEFEKNVA
LLDEQCKKNPGFAAVVKDFEMSPRCASLALKHYLLKPVQRIPQYRLLLTDYLKNLIEESA
DYRDTQALDALAVVIEVANHANDIMKQGDNFQKLMQIQYSLNGHHEIVQPGRVFLKEGTL
MKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRKPTQEAYQNELKIES
VERSFILSASSAMERDEWLEAISRSIEDYTKKRITFYPSKSIDETDTEKEEEVSPLGSKA
PIWIPDTRVTMCMLCTSEFTLTWRRHHCRACGKIVCQACSSNNYGLDYLKNQPARVCERC
FEQLQKQDHQHSPKPGSPANHKSTSSALSSVLQSIPSGRKQKKIPAALKEVSANTEDSSM
SGYLYRSKGSKKPWKHLWFVIKNKVLYTYAASEDIAALESQPLLGFTVTEVKDENSESKV
FHLLHKNILFYVFKADDPHSAQKWIEAFQEGTIL
Download sequence
Identical sequences 9258.ENSOANP00000010551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]