SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000017247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000017247
Domain Number 1 Region: 1338-1539
Classification Level Classification E-value
Superfamily PH domain-like 4.06e-33
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 1015-1178
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-26
Family DBL homology domain (DH-domain) 0.006
Further Details:      
 
Domain Number 3 Region: 1164-1285
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000017247
Sequence length 1541
Comment (Ornithorhynchus anatinus)
Sequence
SQEKKRKDQKSVCTGKLMVLDLPKPPLAPKPKIAGHLSPVAISKFPSLPRPDILQSPNSM
SRGPKPPIAPKPKLAADEGRCSVYMNNNLNKCSNGKLICPDGEIYERNQCNTECSEPEAD
DEYIVVPGSLLAEEDYKVLAHEQHKCYVENESAAAPEASEEEEKKEEDPSTANEGDDCSA
KATTDRPSQGPLVAREAQDPGFEDPGDVDCEDDPGQKEEENLVKDNNEYNLENKKILNGS
EDLKDSVCEDIILTPIAIDEPESNVEKPGDEQQLSNVKDANGEENAEPIALENYDLTHLD
VPPAEEEAQVGVDRHVLKATSEMVPEDDEAASTELDPESPERENEVTLAEGVDEDGGYQN
IEVKNSEVTDTNLDLREDSQVDEDAMREETADDNCQIIPFENEGSDDLVENSYEFFQTES
TSFCSDNYSSFLDSVVESEEEVAMSKEHVNREVAGVGSGKEKTQENEGGETLLIPNVVVM
SEGVSEDETVERTHTKTYGMGSSLICRADNPLLGDLGHPETGENLAGSYNVKEEINADAD
NNLLPTDRKSIITRSRSHSGKVPGYVPETVPEETGPEVDLPILNHERAAGEISKNLLPVE
GKPLEISRALPAKPRRFILYPRSFSVEGRDIPVSVYREGDGSLLDESRIKRKEDNLSLPC
VIGSSGSFSQRSHLPPSSMSTPSSVVDIPPPFELACITKKPITKSSPSLLIENESPDKYT
KKKKSSFKRFLALTFKKRTESKVHVDVNVSSSRSSSESSYHGPSRLMDMDRRSLSNSPQL
KTRSGKLRASESPSAIIFYKDGKRKATPFSRSVSRVESFEDRSRPPFMPLPLTKPRSISF
PNADTSDYENIPAMNSDYENIQIPPRRPTRAGTFTEFFEDPSRALSTANENDGYVDMSSF
NAFESKQQASDQETERNYVYVHKCCGAEGGTRDDTTEEDGQGSGEMQDKGLRDPSVGSVG
HASSHLTVLAQFLCSAIDSYCSVPAHLVYVFCGAVLKVLGEENEEEEGVPGTGNLKLGLN
ELSSIYELHQEILDELEARIQHWVEEQPKLTDVFLTRASRFNHHTAYIMQFDKNLALLDE
NCLKSSQLATTIQEFENSRIGVARPVPARMVWPGNSLCLLSLLLTDYLNNLCPDSAEYEG
TQAALVIVSEVADRANDSMEQGENLQKLVHIEHSVRGQSNLLQPGREFLKEGTLMKVTGK
NRHPRHLFLMNDVLLYTYPQKDGKYRLKNTLAVSGMRVKAPYLPTQTLSLNPIGGMSRPQ
GCLTLVSDSSCSERDEWYSCISRALPDDYKIHTLAAFHNSVEIRERLGICLGERPPTLVP
VSHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRLAKVCDGCYAELK
KRGGDVPILLRERPVSMSFPMSSSRFSGSAFSSVFHSIHPSTFKKQKKIPSALLEVAASG
EGSAISGYLSRCKKGKRHWKKLWFVIKGKVLYTYMASEDKVATESMPLLGFTISPEKEEG
SSEVGPIFHLYHKQTLFYSFKAEDSNSAQRWIEAMEEATVL
Download sequence
Identical sequences F7AE47
ENSOANP00000017247 9258.ENSOANP00000017247 ENSOANP00000017248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]