SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000023386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000023386
Domain Number 1 Region: 91-150
Classification Level Classification E-value
Superfamily RING/U-box 2.71e-18
Family ZZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 381-430
Classification Level Classification E-value
Superfamily UBA-like 1.43e-16
Family UBA domain 0.00017
Further Details:      
 
Domain Number 3 Region: 9-77
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000118
Family PB1 domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000023386
Sequence length 434
Comment (Ornithorhynchus anatinus)
Sequence
RSKAYLLGKEESHREIRRFTRCDRLLRRLDQVFPALRPGTFQAYYRDEDGDMIAFSSDEE
LKMALPYVKDNILRIFIKVEKRECKREHRPPCSQEPPQNMVHPNVTCDGCQGPVVGTRFK
CSICPDYDLCSTCEAKGIHKEHHMLVFQNPFLYPAEWFSRSRWLRKMRHGGFPPFAWVQG
CGHGPPAPTCPNAGQAQASDAPPDSSEEQARDPNVAFLQDVGESVAAILSPLGIEVDIDV
EHGGKRSRVSPPSQPSSRSSSDAQGGSQPSSCSSDQNRPEEEEGGSSGSTLVSLSEEMRK
IKVESPVPLEQSLLPQEQAESGNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESENPYSV
DPPQEEGPTGLREAALYPHLPPEADPHLIESLSQMLSMGFSDEGGWLTRLLQTKNCDIGA
ALDAIQYSKHPPHP
Download sequence
Identical sequences F7BXQ2
ENSOANP00000023386 ENSOANP00000023386 9258.ENSOANP00000023386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]