SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000025216 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000025216
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-24
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000025216
Sequence length 90
Comment (Ornithorhynchus anatinus)
Sequence
QTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVPLGERLAKPERGKMRVHKISNVN
KALDFIASKGVKLVSIGAEDEVTEAQRSEV
Download sequence
Identical sequences F6PLC8
ENSOANP00000025216 9258.ENSOANP00000025216 ENSOANP00000025216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]