SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000002775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000002775
Domain Number 1 Region: 257-407
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-50
Family SSRP1-like 0.0000804
Further Details:      
 
Domain Number 2 Region: 519-590
Classification Level Classification E-value
Superfamily HMG-box 0.000000000144
Family HMG-box 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000002775
Sequence length 684
Comment (Dasypus novemcinctus)
Sequence
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELMEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEXXXXXXXXXXXXX
XXXXXXXXXXXXGMNPSYHDANSDEDWHDAYLEWMKEGGKIQEKHVSDSSVDSEETFDSS
TSASSSSNEGDNDWKKQQKQLKKAKMAKDHKSHKQPMGAKKGKDPSAPKRPMSGYMLLNA
SERIKLGHPSISITDLFKAGEIWKASKEKKEEWDCKAEDARKEYEKVMKEREGGWGESSK
WGSKKKKPKIKMEKKSMPSRSSLSKSSSRRLSDIFKSKEFVSSDESSSEENKNKQKRRQS
EDSEEEELASTPPKSEDSASGSGE
Download sequence
Identical sequences 9361.ENSDNOP00000002775 ENSDNOP00000002775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]