SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000002790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000002790
Domain Number 1 Region: 223-478
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.91e-64
Family Eukaryotic proteases 0.000000165
Further Details:      
 
Domain Number 2 Region: 43-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-24
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 
Weak hits

Sequence:  9361.ENSDNOP00000002790
Domain Number - Region: 194-231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000302
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000002790
Sequence length 482
Comment (Dasypus novemcinctus)
Sequence
QVHTIWRSPRCMASCPGTMWWLFLWGALQVCPTWSRVLLARRLPQTLMPPRYPEPYLKGQ
ECAADIRAPEGLAVKLVFQDFDLEPSPHCERDSVTITASETTLGRFCGQQGPPLGSAPGQ
REFVSLDGRLQLTFHTGASSEDRASTLHKGFLALYQAVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPYYQAVPAGTLTCAAPGTWKDAQGRVEVPQCVPVCGRPVTPLAQSQEA
RGSLRAEPGSFPWQALTNIHGRAGGALLGDRWVLTAAHTLYPKDHVSQGRNLSVGVFLGH
THAEEMIKLGSHPVRRVAVHPDYRQHEPGDFDGDIALLELEKSVPLGAHLLPVCLPSSET
QYRRGTWGYVSGFGVENGRFAPELKYFRLPVAPRKACEAWLRERGRTEVFSENMFCVGET
TRQQGVCQGDSGGAFVVWDDLARRWVATGIVSWGIGCGKGYDFYTKVLNYVDWIRAVMEG
TD
Download sequence
Identical sequences ENSDNOP00000002790 9361.ENSDNOP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]