SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000004411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000004411
Domain Number 1 Region: 38-91
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000572
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000004411
Sequence length 2291
Comment (Dasypus novemcinctus)
Sequence
IYTDANHYLAKSGHKRLLILQQDADGXXXXXXXXXXXNEKVEDINGCPRSQSQMIENVDV
CLSFLAARGVNVQGLSAEEIRNGNLKAILGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLAARYATQSNHSGIATSQKKPTRLPGPSRVPAAGSSNKVQ
GASNLNRRSQSFNSIDKNKPPNYANGNEKDSSKGPQPSSGVNGNMQPPITAGQPPASAIP
SPSASKPWRSKSMNVKHSATSTMLAVKQSSPATSPTPSSDRLKPPVSEGPKTATSGQKSM
LEKFKLVNTRTALRPPQCPSSGLSDGGKDEDVFSESGEMDGINSSMNSGGSTNSSPKVSP
KLAPPKAGSKNLSNKKSLLQPKEKEEKNRDKNKVCTEKLVKEEKDQVTETAPKKTSKIAS
LIPKGSKTMAAKKESLIPSSSGIPKPGSKVPTAKQTISPSSAASKESEKFRTTKGSPSQS
LPKPTTTEKASTETGQGSPSGSCTLPVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXAHSENEGTSLPSADSCTSPTKMDLSYSKTAKQCLEEISXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXWDDSSSVSSGLSDTLDNISTDDLNTASSVSSYSNITVPSRKNTQLKTDAEKRSTT
DENWDSTEELRKTEEDTDCHGDGGGKWKGVSSGLPEDPEKVGQKASLSVSQTGSWRRGMS
AQGGSPSRQKAGTGALKTPGKTDDAKASEKGKSPLKGTSLQRSPSDAGKSSGDEGKKPPS
GIGRSTATSSFGFKKPSTVGSSTMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSL
DGSQNQDDVVLHVSAKSTLQYRSLPRPSKSSPSGIPGRGGHRSSTSSIDSNVSSKSAGAT
TSKLREPTKIGSGRSSPVTANQTDKEKEKVAVSDSESVSLSGSPKSSPTSANACGTQGLR
QPGSKYPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSG
TGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSLASSPASVHSFTSGGLVWAANLSSSS
AGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESM
QLDRNTLPKKGLRYTPSSRQASQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSATGK
YHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSFDLYDDSQLCGSATSLEERPRAISHS
GSFRDSMEEXXXXXXXXXXXXXXXXXXXXXXXXXXQIHKLRRELVASQEKVATLTSQLSA
NAHLVAAFEKSLGNMTGRLQSLTMTAEQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLRIRRQHSSESVSSINSATSHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFK
QAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASASPLVWPPK
KRQNGPVIYKHRSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNEIEILKAENDRLKAETGNTAKPARPPSESSSSTSSSSSRQSLGLSLNNLNITES
VTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXEYVFRIDTSSSLGLSSDCIANYCIGDLIRSHKLDLPELLPCGYLVGDNNIIT
VNLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXELQQYLANLAEQCSADNNGIELPVVIILDNLHHVGSL
SDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRYLRR
KLIEIEIERNTRNNDLVKIVDWIPKTWHHLNSFLETHSSSDVTIXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMNMLMKLQEAANYSGTQSCDSDSTSHHE
DVLDSSLESTL
Download sequence
Identical sequences 9361.ENSDNOP00000004411 ENSDNOP00000004411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]