SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000008894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000008894
Domain Number 1 Region: 348-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-19
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 40-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.42e-18
Family SCAN domain 0.0027
Further Details:      
 
Domain Number 3 Region: 309-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000215
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000008894
Sequence length 433
Comment (Dasypus novemcinctus)
Sequence
MALDLRTSFRHDPSRSGHPGSHNLELEPTQGCDLQRREGNSKFQGPQLSLYQTSNGSFAK
QELKRLRKVFHLWLQPEKHSKEEIISQLILEQLVMNGYCRNRSILKEKWDSSGRNLEKLV
GELNDDCMKSPDFVHVHMQGQEALFSENMPLREVIYLMEQMPAGTPRGESMRTPFQGPQN
IPLQTGHGDEYKDDSNIFVKRNQINVNITSQGNQVPYVVIIQEDDSPKPEEGSGSWKNLH
NFRRAELGSPTSQEGSLGESSSQDVPMEVETQFLPRTDQASPKPALTNQSSDGTSRCGIN
QERVHSPPKSYKCEDCPRIFRFPSQLEAHQRRHRNERPFVCTECHKGFFQTSDLHVHQKI
HMAEKPFRCSSCERSFSHKTNLLAHERIHSGDKPYVCSLCKKSYRQSSTYHRHVRMHQKI
NLKSDSATPEASS
Download sequence
Identical sequences 9361.ENSDNOP00000008894 ENSDNOP00000008894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]