SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000011731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000011731
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.12e-45
Family TRADD, N-terminal domain 0.000002
Further Details:      
 
Domain Number 2 Region: 166-250
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000565
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000011731
Sequence length 257
Comment (Dasypus novemcinctus)
Sequence
SGGSPDVLQMLKIHRSDRQLIVQLRFCGRQPCSRFLRAYREGALRAELQRCLAAALALSS
LPLQLELRAGAERLDTMLLEEERCLNCIFAQKPDRLRDEELAELEDALRGLTCGPGVQGD
DVEVPLAPSQSLTPSPSEKSPSPSQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGR
SLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELT
SLAENLLGLADPDNGLA
Download sequence
Identical sequences 9361.ENSDNOP00000011731 ENSDNOP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]