SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9361.ENSDNOP00000015378 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9361.ENSDNOP00000015378
Domain Number 1 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 209-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.45e-17
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 405-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-16
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 5 Region: 129-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000781
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 261-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000185
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000471
Family KRAB domain (Kruppel-associated box) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9361.ENSDNOP00000015378
Sequence length 458
Comment (Dasypus novemcinctus)
Sequence
MLEDSVTLDNVTLYLTKKEWLRPGPEQRTLEYYGNVTSVAGVPVLNPALVSHLAPGQVLL
VSEPSLHVDRAEHSESMAVRQKTVGEAAPPLEVASASSPRAADPGPEVRQRGVSAGRSGS
PPNLPVEHHFACKECGDTFRLKVLLVQHQRIHSEEKGWECHDCGQVFRGVSAFNEHRKVH
VTVEPRPGPSRALEDAAVAKREQVEREAKPFECEECGKRFKKNAGLSQHLRVHSRDKPFQ
CEECGRSFKVTTHLLRHQKLHAAEKPFACKACSRGFLDRQELLKHQRVHSGPLPFDHDDC
SPSFWGVIGLAEPQRLHGGAKPYGCPHCGKLFRRSSELTKHRRVHTGEKPYECGQCGKAF
RQSSSLLEHQRIHTGERPYECGDCSKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSS
GLSRHRRTHGGARRCECSECGRVFKRRSALQKHQPTHE
Download sequence
Identical sequences ENSDNOP00000015378 9361.ENSDNOP00000015378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]