SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000000156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000000156
Domain Number 1 Region: 228-497
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-80
Family Protein kinases, catalytic subunit 0.00000000014
Further Details:      
 
Domain Number 2 Region: 118-260
Classification Level Classification E-value
Superfamily SH2 domain 1.57e-38
Family SH2 domain 0.00000172
Further Details:      
 
Domain Number 3 Region: 60-142
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-22
Family SH3-domain 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000000156
Sequence length 505
Comment (Macaca mulatta)
Sequence
RMGCMKSKFLQSGGNTFSKTETSANPHCPVYVPDPTSTIKPGPNSNNRNTPGIGEGSEDI
IVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET
EEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIR
TLDNGGFYISPRSTFSTLQELVDHYKKGSDGLCQKLSVPCVSSKPQKPWEKDAWEIPRES
LKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLVKLH
AVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRD
LRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVW
SFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNRPEER
PTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences ENSMMUP00000000156 9544.ENSMMUP00000000156 ENSMMUP00000000156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]