SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000000267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000000267
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000134
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 266-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000303
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000000267
Sequence length 302
Comment (Macaca mulatta)
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALGSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
Download sequence
Identical sequences ENSMMUP00000000267 9544.ENSMMUP00000000267 ENSMMUP00000000267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]