SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000001226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000001226
Domain Number 1 Region: 26-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000946
Family V set domains (antibody variable domain-like) 0.0000065
Further Details:      
 
Weak hits

Sequence:  9544.ENSMMUP00000001226
Domain Number - Region: 140-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.013
Family C2 set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000001226
Sequence length 328
Comment (Macaca mulatta)
Sequence
GPQYTMGLSNTLFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNRSLSELVVFWQNQE
NLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMI
RIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIE
YDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQP
PPDHIPWITAVLPTVIICVMAFCLILWKWKKKKQPRNSYKCGTNTMEREESEQTKKREKI
NVPERSDEAQCVFKSLKTPSCDKSDTHF
Download sequence
Identical sequences 9544.ENSMMUP00000001226 ENSMMUP00000001226 ENSMMUP00000001226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]