SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9544.ENSMMUP00000001601 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9544.ENSMMUP00000001601
Domain Number 1 Region: 37-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000721
Family Ovomucoid domain III-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9544.ENSMMUP00000001601
Sequence length 97
Comment (Macaca mulatta)
Sequence
MARSFPLVSLLPFVLIHLVLSSVSGPRHWWPPHGIIKVKCPYEKVNLSWYNGTVNPCPGL
YQPICGTNFITYDNPRILCVESLKSHGRIRFYHDGKC
Download sequence
Identical sequences ENSMMUP00000001601 XP_001096505.1.72884 ENSMMUP00000001601 9544.ENSMMUP00000001601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]